From 560b016485dacea6cc9340dfd76568d0adc131cf Mon Sep 17 00:00:00 2001 From: iou1name Date: Mon, 11 Jun 2018 09:33:52 -0400 Subject: [PATCH] first commit --- .gitignore | 2 + README.md | 24 + static/languages.json | 16188 +++++++++++++++++++++++++++++++++++++ static/missionTypes.json | 59 + static/solNodes.json | 1792 ++++ warbot.py | 194 + 6 files changed, 18259 insertions(+) create mode 100644 .gitignore create mode 100644 README.md create mode 100644 static/languages.json create mode 100644 static/missionTypes.json create mode 100644 static/solNodes.json create mode 100755 warbot.py diff --git a/.gitignore b/.gitignore new file mode 100644 index 0000000..279be3d --- /dev/null +++ b/.gitignore @@ -0,0 +1,2 @@ +*.cfg +*.swp diff --git a/README.md b/README.md new file mode 100644 index 0000000..9e07996 --- /dev/null +++ b/README.md @@ -0,0 +1,24 @@ +# WarBot +Because I can't name projects to save my life. +WarBot (working title) is an IRC bot which joins channel and periodically checks Warframe's public API for new alerts and announces them into the channel. More features coming soon. + +## Dependencies +Python 3.6+ +`twisted requests` + +## Config +`server` - Server address. +`port` - Server port. SSL probably won't work. +`nickname` - The bot's nickname. +`username` - The user ident. +`channel` - The channel to join and spam alerts to. + +### Example config.cfg +``` +[default] +server = irc.steelbea.me +port = 6667 +nickname = Cephalon +ident = Cephalon +channel = #warframe +``` diff --git a/static/languages.json b/static/languages.json new file mode 100644 index 0000000..15f2602 --- /dev/null +++ b/static/languages.json @@ -0,0 +1,16188 @@ +{ + "/ee/types/engine/mover": { + "value": "Mover" + }, + "/lotus/characters/sentient/hunhow/hunhowpieces/hunhowhipswreckagequest": { + "value": "Hunhow Hips Wreckage Quest" + }, + "/lotus/characters/tenno/accessory/scarves/grnbannerscarf/grnbannerscarfitem": { + "value": "Vanquished Banner" + }, + "/lotus/characters/tenno/accessory/scarves/u17intermscarf/u17intermscarfitem": { + "value": "Udyat Syandana" + }, + "/lotus/language/alerts/aladcargoevent": { + "value": "Suspicious Shipment" + }, + "/lotus/language/alerts/alertrewardcategoryaura": { + "value": "Aura" + }, + "/lotus/language/alerts/alertrewardcategoryblueprint": { + "value": "Blueprint" + }, + "/lotus/language/alerts/alertrewardcategoryitem": { + "value": "Item" + }, + "/lotus/language/alerts/alertrewardcategorymod": { + "value": "Mod" + }, + "/lotus/language/alerts/alertrewardcategoryresource": { + "value": "Resource" + }, + "/lotus/language/alerts/alertrewardcategorystance": { + "value": "Stance Mod" + }, + "/lotus/language/alerts/assassinationdesc1": { + "value": "Enemy VIP Located" + }, + "/lotus/language/alerts/assassinationdesc10": { + "value": "Enemy Intelligence Officer Located" + }, + "/lotus/language/alerts/assassinationdesc11": { + "value": "Elite Troop Located" + }, + "/lotus/language/alerts/assassinationdesc12": { + "value": "Enemy Ambassador Located" + }, + "/lotus/language/alerts/assassinationdesc13": { + "value": "Enemy Robotic Archetype Located" + }, + "/lotus/language/alerts/assassinationdesc14": { + "value": "Enemy Officer Located" + }, + "/lotus/language/alerts/assassinationdesc15": { + "value": "Enemy Sniper Located" + }, + "/lotus/language/alerts/assassinationdesc2": { + "value": "Enemy Ship Commander Located" + }, + "/lotus/language/alerts/assassinationdesc3": { + "value": "Enemy Research Scientist Located" + }, + "/lotus/language/alerts/assassinationdesc4": { + "value": "Enemy Bureaucrat Located" + }, + "/lotus/language/alerts/assassinationdesc5": { + "value": "Enemy Munitions Officer Located" + }, + "/lotus/language/alerts/assassinationdesc6": { + "value": "Enemy Diplomat Located" + }, + "/lotus/language/alerts/assassinationdesc7": { + "value": "Enemy Spy Located" + }, + "/lotus/language/alerts/assassinationdesc8": { + "value": "Enemy Assassin Located" + }, + "/lotus/language/alerts/assassinationdesc9": { + "value": "Enemy Operative Located" + }, + "/lotus/language/alerts/capturedesc1": { + "value": "Fugitive Located" + }, + "/lotus/language/alerts/capturedesc10": { + "value": "Enemy Research Scientist Located" + }, + "/lotus/language/alerts/capturedesc11": { + "value": "Enemy Weapons Trader Located" + }, + "/lotus/language/alerts/capturedesc12": { + "value": "Enemy Conspirator Located" + }, + "/lotus/language/alerts/capturedesc13": { + "value": "Relic Hunter Located" + }, + "/lotus/language/alerts/capturedesc14": { + "value": "Enemy Courier Located" + }, + "/lotus/language/alerts/capturedesc15": { + "value": "Capture And Interrogate Enemy Operative" + }, + "/lotus/language/alerts/capturedesc2": { + "value": "Enemy Operative Located" + }, + "/lotus/language/alerts/capturedesc3": { + "value": "Enemy Spy Located" + }, + "/lotus/language/alerts/capturedesc4": { + "value": "Enemy Assassin Located" + }, + "/lotus/language/alerts/capturedesc5": { + "value": "Enemy Diplomat Located" + }, + "/lotus/language/alerts/capturedesc6": { + "value": "Subdue Enemy Ship's Commander" + }, + "/lotus/language/alerts/capturedesc7": { + "value": "Subdue Facility Commander" + }, + "/lotus/language/alerts/capturedesc8": { + "value": "Blackmarket Trader Located" + }, + "/lotus/language/alerts/capturedesc9": { + "value": "Research Facility Director Located" + }, + "/lotus/language/alerts/corpuslootship": { + "value": "Corpus Treasury Ship Located" + }, + "/lotus/language/alerts/counterinteldesc1": { + "value": "Network Vulnerability Detected" + }, + "/lotus/language/alerts/counterinteldesc10": { + "value": "Enemy Comm Satellite Vulnerable" + }, + "/lotus/language/alerts/counterinteldesc11": { + "value": "Reconfigure Enemy Ship's Propulsion System" + }, + "/lotus/language/alerts/counterinteldesc12": { + "value": "Reconfigure Enemy Ship's Defense System" + }, + "/lotus/language/alerts/counterinteldesc13": { + "value": "Reconfigure Enemy Ship's Shields" + }, + "/lotus/language/alerts/counterinteldesc14": { + "value": "Contaminate Research Data" + }, + "/lotus/language/alerts/counterinteldesc15": { + "value": "Reprogram Turret Targeting" + }, + "/lotus/language/alerts/counterinteldesc16": { + "value": "Plant A Bug Inside Research Facility" + }, + "/lotus/language/alerts/counterinteldesc17": { + "value": "Plant A Bug On Enemy Vessel" + }, + "/lotus/language/alerts/counterinteldesc18": { + "value": "Plant A Bug Inside Enemy Facility" + }, + "/lotus/language/alerts/counterinteldesc19": { + "value": "Corrupt The Ship's Network Protocols" + }, + "/lotus/language/alerts/counterinteldesc2": { + "value": "Enemy Comm Station Vulnerable" + }, + "/lotus/language/alerts/counterinteldesc20": { + "value": "Corrupt The Facility's Network Protocols" + }, + "/lotus/language/alerts/counterinteldesc21": { + "value": "Upload Virus To Network" + }, + "/lotus/language/alerts/counterinteldesc22": { + "value": "Reprogram Robotic Control Terminals" + }, + "/lotus/language/alerts/counterinteldesc23": { + "value": "Bypass Ship's Security Measures" + }, + "/lotus/language/alerts/counterinteldesc24": { + "value": "Redirect Enemy Flagship" + }, + "/lotus/language/alerts/counterinteldesc25": { + "value": "Corrupt Robotic Archetype Data" + }, + "/lotus/language/alerts/counterinteldesc3": { + "value": "Redirect Enemy Vessel" + }, + "/lotus/language/alerts/counterinteldesc4": { + "value": "Transmit Corrupt Data To Computer Core" + }, + "/lotus/language/alerts/counterinteldesc5": { + "value": "Upload Counter Intel To Enemy Satellites" + }, + "/lotus/language/alerts/counterinteldesc6": { + "value": "Reconfigure Enemy Ship's Navigation System" + }, + "/lotus/language/alerts/counterinteldesc7": { + "value": "Reconfigure Enemy Ship's Weapons System" + }, + "/lotus/language/alerts/counterinteldesc8": { + "value": "Reconfigure Enemy Ship's Targeting System" + }, + "/lotus/language/alerts/counterinteldesc9": { + "value": "Reconfigure Enemy Ship's Comm System" + }, + "/lotus/language/alerts/darvomobiledefensedesc": { + "value": "After provoking the wrong people, the independent 'merchant' Darvo had to go into hiding. Now he needs your help so that he can get his business back on track." + }, + "/lotus/language/alerts/darvomobiledefensetitle": { + "value": "A Favor for Darvo" + }, + "/lotus/language/alerts/darvorescuetitle": { + "value": "Ties That Bind" + }, + "/lotus/language/alerts/defensedesc1": { + "value": "Freighter Ambush" + }, + "/lotus/language/alerts/defensedesc10": { + "value": "Defend Enemy Science Lab" + }, + "/lotus/language/alerts/defensedesc11": { + "value": "Secure The Artifacts" + }, + "/lotus/language/alerts/defensedesc11long": { + "value": "A rare artifact has been ambushed in transit. Keep it out of enemy hands." + }, + "/lotus/language/alerts/defensedesc12": { + "value": "Weapons Cache Compromised" + }, + "/lotus/language/alerts/defensedesc13": { + "value": "Secure The Rubedo Mining Outpost" + }, + "/lotus/language/alerts/defensedesc14": { + "value": "Secure Derelict Ship" + }, + "/lotus/language/alerts/defensedesc15": { + "value": "Repel Enemy Attack" + }, + "/lotus/language/alerts/defensedesc16": { + "value": "Protect Research Scientist" + }, + "/lotus/language/alerts/defensedesc17": { + "value": "Solar Rail Ambush" + }, + "/lotus/language/alerts/defensedesc18": { + "value": "Protect Hostage" + }, + "/lotus/language/alerts/defensedesc19": { + "value": "Protect Sensitive Data" + }, + "/lotus/language/alerts/defensedesc2": { + "value": "Research Facility Ambush" + }, + "/lotus/language/alerts/defensedesc20": { + "value": "Secure The Computer Core" + }, + "/lotus/language/alerts/defensedesc21": { + "value": "Research Analysis Compromised" + }, + "/lotus/language/alerts/defensedesc3": { + "value": "Mining Facility Ambush" + }, + "/lotus/language/alerts/defensedesc4": { + "value": "Defend Data Core During Transmission" + }, + "/lotus/language/alerts/defensedesc5": { + "value": "Warframe Compromised" + }, + "/lotus/language/alerts/defensedesc6": { + "value": "Enemy Informant Compromised" + }, + "/lotus/language/alerts/defensedesc7": { + "value": "Tenno Operative Compromised" + }, + "/lotus/language/alerts/defensedesc8": { + "value": "Secure Ship Cargo" + }, + "/lotus/language/alerts/defensedesc9": { + "value": "Hold Out For Reinforcements" + }, + "/lotus/language/alerts/exterminationdesc1": { + "value": "Tenno Distress Signal" + }, + "/lotus/language/alerts/exterminationdesc10": { + "value": "Artifact Recovery Troops Located" + }, + "/lotus/language/alerts/exterminationdesc11": { + "value": "Enemy Shock Troops Located" + }, + "/lotus/language/alerts/exterminationdesc12": { + "value": "Clear And Secure Enemy Vessel" + }, + "/lotus/language/alerts/exterminationdesc13": { + "value": "Defeat Enemy Ambush" + }, + "/lotus/language/alerts/exterminationdesc14": { + "value": "Clear Resistance" + }, + "/lotus/language/alerts/exterminationdesc15": { + "value": "Secure Excavation Site" + }, + "/lotus/language/alerts/exterminationdesc2": { + "value": "Unknown Distress Signal Located" + }, + "/lotus/language/alerts/exterminationdesc3": { + "value": "Enemy Security Forces Located" + }, + "/lotus/language/alerts/exterminationdesc4": { + "value": "Enemy Support Squadrons Located" + }, + "/lotus/language/alerts/exterminationdesc5": { + "value": "Enemy Task Force Located" + }, + "/lotus/language/alerts/exterminationdesc6": { + "value": "Elite Troops Located" + }, + "/lotus/language/alerts/exterminationdesc7": { + "value": "Defeat Enemy Defense Forces" + }, + "/lotus/language/alerts/exterminationdesc8": { + "value": "Enemy Escorts Located" + }, + "/lotus/language/alerts/exterminationdesc9": { + "value": "Enemy Recon Unit Located" + }, + "/lotus/language/alerts/grineerlootship": { + "value": "Grineer Treasury Ship Located" + }, + "/lotus/language/alerts/infestedepidemiceventa": { + "value": "Mutalist Incursion" + }, + "/lotus/language/alerts/inteldesc1": { + "value": "Research Facility Discovered" + }, + "/lotus/language/alerts/inteldesc10": { + "value": "Acquire Security Logs" + }, + "/lotus/language/alerts/inteldesc11": { + "value": "Scan Ship For Suspicious Objects" + }, + "/lotus/language/alerts/inteldesc12": { + "value": "Scan Enemy Satellites" + }, + "/lotus/language/alerts/inteldesc13": { + "value": "Investigate Ship In Distress" + }, + "/lotus/language/alerts/inteldesc14": { + "value": "Scan Ship's Cargo Logs" + }, + "/lotus/language/alerts/inteldesc15": { + "value": "Enemy Research Located" + }, + "/lotus/language/alerts/inteldesc16": { + "value": "Locate And Scan Cargo Stashes" + }, + "/lotus/language/alerts/inteldesc17": { + "value": "Investigate Distress Beacon" + }, + "/lotus/language/alerts/inteldesc18": { + "value": "Search Enemy Ship's Databanks" + }, + "/lotus/language/alerts/inteldesc19": { + "value": "Investigate The Derelict Ship" + }, + "/lotus/language/alerts/inteldesc2": { + "value": "Artifact Research Facility Discovered" + }, + "/lotus/language/alerts/inteldesc20": { + "value": "Explore Hidden Base" + }, + "/lotus/language/alerts/inteldesc21": { + "value": "Infiltrate Research Station" + }, + "/lotus/language/alerts/inteldesc22": { + "value": "Investigate Mining Facility" + }, + "/lotus/language/alerts/inteldesc23": { + "value": "Examine Ship's Network Protocols" + }, + "/lotus/language/alerts/inteldesc24": { + "value": "Examine Facility Network Protocols" + }, + "/lotus/language/alerts/inteldesc25": { + "value": "Locate Security Codes" + }, + "/lotus/language/alerts/inteldesc26": { + "value": "Enemy Transmissions Located" + }, + "/lotus/language/alerts/inteldesc27": { + "value": "Enemy Freighter Located" + }, + "/lotus/language/alerts/inteldesc28": { + "value": "Enemy Cargo Hold Located" + }, + "/lotus/language/alerts/inteldesc29": { + "value": "Enemy Base Located" + }, + "/lotus/language/alerts/inteldesc3": { + "value": "Weapons Research Facility Discovered" + }, + "/lotus/language/alerts/inteldesc30": { + "value": "Enemy Asteroid Facility Located" + }, + "/lotus/language/alerts/inteldesc31": { + "value": "Research Station Located" + }, + "/lotus/language/alerts/inteldesc32": { + "value": "Distress Call Located" + }, + "/lotus/language/alerts/inteldesc33": { + "value": "Disable Security Beacons" + }, + "/lotus/language/alerts/inteldesc34": { + "value": "Secret Enemy Facility Located" + }, + "/lotus/language/alerts/inteldesc35": { + "value": "Merchant Ship Located" + }, + "/lotus/language/alerts/inteldesc36": { + "value": "Enemy Research Analysis Located" + }, + "/lotus/language/alerts/inteldesc37": { + "value": "Investigate Enemy Distress Signal" + }, + "/lotus/language/alerts/inteldesc38": { + "value": "Collect T-Cyte Reseach Samples" + }, + "/lotus/language/alerts/inteldesc39": { + "value": "Enemy Manufacturing Facility Located" + }, + "/lotus/language/alerts/inteldesc4": { + "value": "Mining Research Station Discovered" + }, + "/lotus/language/alerts/inteldesc40": { + "value": "Cloning Research Facility Located" + }, + "/lotus/language/alerts/inteldesc41": { + "value": "Intercept Enemy Ship" + }, + "/lotus/language/alerts/inteldesc42": { + "value": "Bypass Data Core Lockout" + }, + "/lotus/language/alerts/inteldesc43": { + "value": "Locate And Acquire Robotic Archetype Data" + }, + "/lotus/language/alerts/inteldesc44": { + "value": "Investigate Enemy Facility Distress Signal" + }, + "/lotus/language/alerts/inteldesc45": { + "value": "Acquire Enemy Vessel Cargo Records" + }, + "/lotus/language/alerts/inteldesc46": { + "value": "Investigate Excavation Site" + }, + "/lotus/language/alerts/inteldesc47": { + "value": "Investigate Enemy Outpost" + }, + "/lotus/language/alerts/inteldesc5": { + "value": "Intelligence Vessel Discovered" + }, + "/lotus/language/alerts/inteldesc6": { + "value": "Enemy Ship Located" + }, + "/lotus/language/alerts/inteldesc7": { + "value": "Weapon Prototype Located" + }, + "/lotus/language/alerts/inteldesc8": { + "value": "Weapons Research Located" + }, + "/lotus/language/alerts/inteldesc9": { + "value": "Acquire Ship's Logs" + }, + "/lotus/language/alerts/lotusgiftdesc": { + "value": "Gift From The Lotus" + }, + "/lotus/language/alerts/nightmarealertdesc": { + "value": "Nightmare Mod Located" + }, + "/lotus/language/alerts/orokinoverload": { + "value": "Orokin Overload" + }, + "/lotus/language/alerts/raiddesc1": { + "value": "Weapons Depot Discovered" + }, + "/lotus/language/alerts/raiddesc10": { + "value": "Merchant Ship Discovered" + }, + "/lotus/language/alerts/raiddesc11": { + "value": "Artifact Research Discovered" + }, + "/lotus/language/alerts/raiddesc12": { + "value": "Experimental Weapons Cache Discovered" + }, + "/lotus/language/alerts/raiddesc13": { + "value": "Orokin Artifacts Discovered" + }, + "/lotus/language/alerts/raiddesc14": { + "value": "Warframe Discovered" + }, + "/lotus/language/alerts/raiddesc15": { + "value": "Enemy Tech Discovered" + }, + "/lotus/language/alerts/raiddesc16": { + "value": "Enemy Flagship Discovered" + }, + "/lotus/language/alerts/raiddesc17": { + "value": "Enemy Data Core Discovered" + }, + "/lotus/language/alerts/raiddesc18": { + "value": "Armory Depot Discovered" + }, + "/lotus/language/alerts/raiddesc19": { + "value": "Hidden Base Discovered" + }, + "/lotus/language/alerts/raiddesc2": { + "value": "Artifact Depot Discovered" + }, + "/lotus/language/alerts/raiddesc20": { + "value": "Clandestine Asteroid Base Discovered" + }, + "/lotus/language/alerts/raiddesc21": { + "value": "Artifact Dig Site Discovered" + }, + "/lotus/language/alerts/raiddesc22": { + "value": "Experimental Ballistics Facility Located" + }, + "/lotus/language/alerts/raiddesc23": { + "value": "Weapons Testing Facility Discovered" + }, + "/lotus/language/alerts/raiddesc3": { + "value": "Rubedo Depot Discovered" + }, + "/lotus/language/alerts/raiddesc4": { + "value": "Mining Station Discovered" + }, + "/lotus/language/alerts/raiddesc5": { + "value": "Enemy Intelligence Vessel Discovered" + }, + "/lotus/language/alerts/raiddesc6": { + "value": "Supply Depot Located" + }, + "/lotus/language/alerts/raiddesc7": { + "value": "Armory Depot Discovered" + }, + "/lotus/language/alerts/raiddesc8": { + "value": "Enemy Supply Vessel Discovered" + }, + "/lotus/language/alerts/raiddesc9": { + "value": "Blackmarket Ship Discovered" + }, + "/lotus/language/alerts/rescuedesc1": { + "value": "Hostage Situation" + }, + "/lotus/language/alerts/rescuedesc10": { + "value": "Weapons Researcher Located" + }, + "/lotus/language/alerts/rescuedesc11": { + "value": "Distress Signal Located" + }, + "/lotus/language/alerts/rescuedesc12": { + "value": "Foreign Emissary Located" + }, + "/lotus/language/alerts/rescuedesc13": { + "value": "Blackmarket Weapons Dealer Located" + }, + "/lotus/language/alerts/rescuedesc14": { + "value": "Abducted Civilian" + }, + "/lotus/language/alerts/rescuedesc2": { + "value": "Enemy Informant Located" + }, + "/lotus/language/alerts/rescuedesc3": { + "value": "Tenno Operative Located" + }, + "/lotus/language/alerts/rescuedesc4": { + "value": "Tenno Sympathizer Located" + }, + "/lotus/language/alerts/rescuedesc5": { + "value": "Detained Research Scientist Located" + }, + "/lotus/language/alerts/rescuedesc6": { + "value": "Detained Diplomat Located" + }, + "/lotus/language/alerts/rescuedesc7": { + "value": "Detained Refugee Located" + }, + "/lotus/language/alerts/rescuedesc8": { + "value": "Enemy Turncoat Located" + }, + "/lotus/language/alerts/rescuedesc9": { + "value": "Enemy Envoy Located" + }, + "/lotus/language/alerts/sabotagedesc1": { + "value": "Enemy Transport Found" + }, + "/lotus/language/alerts/sabotagedesc10": { + "value": "Enemy Comm Satellite Located" + }, + "/lotus/language/alerts/sabotagedesc11": { + "value": "Deactivate Shields" + }, + "/lotus/language/alerts/sabotagedesc12": { + "value": "Shutdown Ship's Fission Core" + }, + "/lotus/language/alerts/sabotagedesc13": { + "value": "Disable Enemy Ship's Power Systems" + }, + "/lotus/language/alerts/sabotagedesc14": { + "value": "Enemy Munitions Dump Located" + }, + "/lotus/language/alerts/sabotagedesc15": { + "value": "Destroy Experimental Weapons" + }, + "/lotus/language/alerts/sabotagedesc16": { + "value": "Destroy Research Station's Defenses" + }, + "/lotus/language/alerts/sabotagedesc17": { + "value": "Destroy Research Vessel's Defenses" + }, + "/lotus/language/alerts/sabotagedesc18": { + "value": "Destroy Enemy Base Defenses" + }, + "/lotus/language/alerts/sabotagedesc19": { + "value": "Disable Enemy Satellites" + }, + "/lotus/language/alerts/sabotagedesc2": { + "value": "Enemy Facility Found" + }, + "/lotus/language/alerts/sabotagedesc20": { + "value": "Disable Navigation Beacon" + }, + "/lotus/language/alerts/sabotagedesc21": { + "value": "Destroy Enemy Devices" + }, + "/lotus/language/alerts/sabotagedesc22": { + "value": "Override Ship's Security Systems" + }, + "/lotus/language/alerts/sabotagedesc23": { + "value": "Override Facility's Security Systems" + }, + "/lotus/language/alerts/sabotagedesc24": { + "value": "Deactivate Computer Core Defenses" + }, + "/lotus/language/alerts/sabotagedesc25": { + "value": "Disable Ship Artillery Systems" + }, + "/lotus/language/alerts/sabotagedesc26": { + "value": "Sabotage Enemy Research Facility" + }, + "/lotus/language/alerts/sabotagedesc27": { + "value": "Destroy Munitions Stockpile" + }, + "/lotus/language/alerts/sabotagedesc28": { + "value": "Disable Communications Network" + }, + "/lotus/language/alerts/sabotagedesc29": { + "value": "Destroy Ammo Cache" + }, + "/lotus/language/alerts/sabotagedesc3": { + "value": "Weapons Depot Found" + }, + "/lotus/language/alerts/sabotagedesc4": { + "value": "Disable Enemy Warship" + }, + "/lotus/language/alerts/sabotagedesc5": { + "value": "Destroy Enemy Transport" + }, + "/lotus/language/alerts/sabotagedesc6": { + "value": "Destroy Enemy Facility" + }, + "/lotus/language/alerts/sabotagedesc7": { + "value": "Destroy Comm Station" + }, + "/lotus/language/alerts/sabotagedesc8": { + "value": "Deactivate Enemy Shields" + }, + "/lotus/language/alerts/sabotagedesc9": { + "value": "Deactivate Turrets" + }, + "/lotus/language/alerts/savedarvotitle": { + "value": "Corpus Bust" + }, + "/lotus/language/alerts/survivaldesc1": { + "value": "Survive or DIE" + }, + "/lotus/language/alerts/survivaldesc1long": { + "value": "Replenish your depleting oxygen supply by killing enemies and holding out for supply drops." + }, + "/lotus/language/bosses/bossthejackal": { + "value": "Boss The Jackal" + }, + "/lotus/language/bosses/bosstylregor": { + "value": "Boss Tyl Regor" + }, + "/lotus/language/g1quests/anniversary2017missiontitle": { + "value": "Gifts of the Lotus - Stolen!" + }, + "/lotus/language/g1quests/fomorianrevengebattlename": { + "value": "Balor Fomorian" + }, + "/lotus/language/g1quests/kelaeventbonustitle": { + "value": "Endless Rathuum" + }, + "/lotus/language/g1quests/kelaeventgoala": { + "value": "Judgement Points Earned" + }, + "/lotus/language/g1quests/kelaeventgoalb": { + "value": "Kela Defeated" + }, + "/lotus/language/g1quests/kelaeventgoalc": { + "value": "Executioners Defeated" + }, + "/lotus/language/g1quests/kelaeventtitle": { + "value": "Operation: Rathuum" + }, + "/lotus/language/g1quests/kelaeventtitleb": { + "value": "Kela de Thaym's Court" + }, + "/lotus/language/g1quests/projectindexendlessgoal": { + "value": "Index Points" + }, + "/lotus/language/g1quests/projectindexendlesstitle": { + "value": "Project Index: Endurance" + }, + "/lotus/language/g1quests/projectindextitle": { + "value": "Project Index" + }, + "/lotus/language/g1quests/projectnightwatchtacalerttitle": { + "value": "Long Shadow Tactical Alert" + }, + "/lotus/language/g1quests/tacalerthalloweentitle": { + "value": "Hallowed Nightmares Tactical Alert" + }, + "/lotus/language/g1quests/tacalertninjavarianttitle": { + "value": "Quick Steel" + }, + "/lotus/language/g1quests/tacalertninjavarianttooltip": { + "value": "Razor sharp Nikana clash with bullet fast Hikou in this amped-up deathmatch variant. Win (Place in top 3) = 3 Points. Loss = 1 Point." + }, + "/lotus/language/game/areacasteracolyte": { + "value": "Misery" + }, + "/lotus/language/game/burstcasteracolyte": { + "value": "Angst" + }, + "/lotus/language/game/controlacolyte": { + "value": "Torment" + }, + "/lotus/language/game/duellistacolyte": { + "value": "Violence" + }, + "/lotus/language/game/heavyacolyte": { + "value": "Malice" + }, + "/lotus/language/game/rogueacolyte": { + "value": "Mania" + }, + "/lotus/language/gamemodes/recurringghoulalert": { + "value": "Ghoul Purge" + }, + "/lotus/language/gamemodes/recurringghoulalertdesc": { + "value": "Help Konzu rid the plains of Grineer Ghouls" + }, + "/lotus/language/infestedplainsevent/infestedplainsbountydesc": { + "value": "Steal Vay Hek's Thrax Toxin, mix it, and poison the Infested Boil growing in the center of the plains." + }, + "/lotus/language/infestedplainsevent/infestedplainsbountyname": { + "value": "Plague Star" + }, + "/lotus/language/items/furaxwraithname": { + "desc": "These Wraith gauntlets have been augmented for power.", + "value": "Furax Wraith" + }, + "/lotus/language/items/kelaeventbadgename": { + "desc": "Awarded to those who stood against Kela De Thaym and her Executioners.", + "value": "Rathuum Badge" + }, + "/lotus/language/items/kelaeventdogtagname": { + "desc": "To be delivered to Steel Meridian or chosen Syndicate in the relay.", + "value": "Rathuum Prisoner Coordinates" + }, + "/lotus/language/items/orokinreactor": { + "value": "Orokin Reactor" + }, + "/lotus/language/menu/corpusinvasiongeneric": { + "value": "Corpus Siege" + }, + "/lotus/language/menu/grineerinvasiongeneric": { + "value": "Grineer Offensive" + }, + "/lotus/language/menu/grineerinvasionleader": { + "value": "Grineer Faction" + }, + "/lotus/language/menu/infestedinvasionboss": { + "value": "Phorid Manifestation" + }, + "/lotus/language/menu/infestedinvasionending": { + "value": "Infestation Subsiding" + }, + "/lotus/language/menu/infestedinvasiongeneric": { + "value": "Infested Outbreak" + }, + "/lotus/language/sigils/kelaeventsigilname": { + "desc": "A sigil commemorating the liberation of defectors from the Grineer.", + "value": "Rathuum Sigil" + }, + "/lotus/objects/crpmegaexplodingbarrel": { + "value": "Crp Mega Exploding Barrel" + }, + "/lotus/objects/explodingbarrelfrozen": { + "value": "Exploding Barrel Frozen" + }, + "/lotus/objects/gameplay/orofusexadeco": { + "value": "Oro Fusex A Deco" + }, + "/lotus/objects/gameplay/orofusexbdeco": { + "value": "Oro Fusex B Deco" + }, + "/lotus/objects/grineer/props/computers/grnpanelablackdeco": { + "value": "Grn Panel A Black Deco" + }, + "/lotus/objects/grineer/props/computers/grnpanelaraiddeco": { + "value": "Grn Panel A Raid Deco" + }, + "/lotus/objects/grnexplodingbarrel": { + "value": "Grn Exploding Barrel" + }, + "/lotus/objects/guild/structural/curvedglassinteriordeco": { + "value": "Curved Glass Interior Deco" + }, + "/lotus/objects/guild/structural/vents/destroyablevent": { + "value": "Destroyable Vent" + }, + "/lotus/objects/orokin/props/collectibleseriesone": { + "value": "Collectible Series One" + }, + "/lotus/objects/tenno/props/titaniacodexentrycdeco": { + "value": "Titania Codex Entry C Deco" + }, + "/lotus/powersuits/antimatter/anti": { + "value": "Nova" + }, + "/lotus/powersuits/antimatter/novaprime": { + "value": "Nova Prime" + }, + "/lotus/powersuits/archwing/demolitionjetpack/demolitionjetpack": { + "value": "Elytron" + }, + "/lotus/powersuits/archwing/primejetpack/primejetpack": { + "value": "Odonata Prime" + }, + "/lotus/powersuits/archwing/standardjetpack/standardjetpack": { + "value": "Odonata" + }, + "/lotus/powersuits/archwing/stealthjetpack/stealthjetpack": { + "value": "Itzal" + }, + "/lotus/powersuits/archwing/supportjetpack/supportjetpack": { + "value": "Amesha" + }, + "/lotus/powersuits/banshee/banshee": { + "value": "Banshee" + }, + "/lotus/powersuits/banshee/bansheeprime": { + "value": "Banshee Prime" + }, + "/lotus/powersuits/bard/bard": { + "value": "Octavia" + }, + "/lotus/powersuits/berserker/berserker": { + "value": "Valkyr" + }, + "/lotus/powersuits/berserker/valkyrprime": { + "value": "Valkyr Prime" + }, + "/lotus/powersuits/brawler/brawler": { + "value": "Atlas" + }, + "/lotus/powersuits/brawler/summonavatarhostile": { + "value": "Summon Avatar Hostile" + }, + "/lotus/powersuits/cowgirl/cowgirl": { + "value": "Mesa" + }, + "/lotus/powersuits/dragon/dragon": { + "value": "Chroma" + }, + "/lotus/powersuits/dragon/dragonpeltavatar": { + "value": "Dragon Pelt Avatar" + }, + "/lotus/powersuits/ember/ember": { + "value": "Ember" + }, + "/lotus/powersuits/ember/emberprime": { + "value": "Ember Prime" + }, + "/lotus/powersuits/excalibur/excalibur": { + "value": "Excalibur" + }, + "/lotus/powersuits/excalibur/excaliburprime": { + "value": "Excalibur Prime" + }, + "/lotus/powersuits/fairy/fairy": { + "value": "Titania" + }, + "/lotus/powersuits/frost/frost": { + "value": "Frost" + }, + "/lotus/powersuits/frost/frostprime": { + "value": "Frost Prime" + }, + "/lotus/powersuits/frost/icespikeaugmentcard": { + "value": "Ice Spike Augment Card" + }, + "/lotus/powersuits/glass/glass": { + "value": "Gara" + }, + "/lotus/powersuits/harlequin/harlequin": { + "value": "Mirage" + }, + "/lotus/powersuits/infestation/infestation": { + "value": "Nidus" + }, + "/lotus/powersuits/jade/jade": { + "value": "Nyx" + }, + "/lotus/powersuits/jade/nyxprime": { + "value": "Nyx Prime" + }, + "/lotus/powersuits/loki/loki": { + "value": "Loki" + }, + "/lotus/powersuits/loki/lokiprime": { + "value": "Loki Prime" + }, + "/lotus/powersuits/mag/mag": { + "value": "Mag" + }, + "/lotus/powersuits/mag/magprime": { + "value": "Mag Prime" + }, + "/lotus/powersuits/magician/magician": { + "value": "Limbo" + }, + "/lotus/powersuits/monkeyking/monkeyking": { + "value": "Wukong" + }, + "/lotus/powersuits/necro/necro": { + "value": "Nekros" + }, + "/lotus/powersuits/necro/nekrosprime": { + "value": "Nekros Prime" + }, + "/lotus/powersuits/nezha/nezha": { + "value": "Nezha" + }, + "/lotus/powersuits/ninja/ashprime": { + "value": "Ash Prime" + }, + "/lotus/powersuits/ninja/ninja": { + "value": "Ash" + }, + "/lotus/powersuits/paladin/paladin": { + "value": "Oberon" + }, + "/lotus/powersuits/paladin/paladinprime": { + "value": "Paladin Prime" + }, + "/lotus/powersuits/pirate/pirate": { + "value": "Hydroid" + }, + "/lotus/powersuits/priest/priest": { + "value": "Priest" + }, + "/lotus/powersuits/ranger/ranger": { + "value": "Ivara" + }, + "/lotus/powersuits/rhino/rhino": { + "value": "Rhino" + }, + "/lotus/powersuits/rhino/rhinoprime": { + "value": "Rhino Prime" + }, + "/lotus/powersuits/sandman/sandman": { + "value": "Inaros" + }, + "/lotus/powersuits/saryn/saryn": { + "value": "Saryn" + }, + "/lotus/powersuits/saryn/sarynprime": { + "value": "Saryn Prime" + }, + "/lotus/powersuits/tengu/tengu": { + "value": "Zephyr" + }, + "/lotus/powersuits/trapper/trapper": { + "value": "Vauban" + }, + "/lotus/powersuits/trapper/trapperprime": { + "value": "Vauban Prime" + }, + "/lotus/powersuits/trinity/trinity": { + "value": "Trinity" + }, + "/lotus/powersuits/trinity/trinityprime": { + "value": "Trinity Prime" + }, + "/lotus/powersuits/volt/volt": { + "value": "Volt" + }, + "/lotus/powersuits/volt/voltprime": { + "value": "Volt Prime" + }, + "/lotus/powersuits/yinyang/yinyang": { + "value": "Equinox" + }, + "/lotus/pvpchallengetypes/pvptimedaffectorsuperenergy": { + "value": "Keep your energy at maximum" + }, + "/lotus/pvpchallengetypes/pvptimedaffectorsupereverything": { + "value": "Kill enemies while sliding" + }, + "/lotus/pvpchallengetypes/pvptimedaffectorsupermeleedamage": { + "value": "Do lots of melee damage" + }, + "/lotus/pvpchallengetypes/pvptimedaffectorsuperpistoldamage": { + "value": "Get a pistol damage boost" + }, + "/lotus/pvpchallengetypes/pvptimedaffectorsuperpowerdamage": { + "value": "Get a kill with an ability" + }, + "/lotus/pvpchallengetypes/pvptimedchallengeflagcaptureeasy": { + "value": "Win a match" + }, + "/lotus/pvpchallengetypes/pvptimedchallengeflagcapturehard": { + "value": "Win a match" + }, + "/lotus/pvpchallengetypes/pvptimedchallengeflagcapturemedium": { + "value": "Win a match" + }, + "/lotus/pvpchallengetypes/pvptimedchallengeflagreturneasy": { + "value": "Return the Cephalon" + }, + "/lotus/pvpchallengetypes/pvptimedchallengeflagreturnhard": { + "value": "Return the Cephalon" + }, + "/lotus/pvpchallengetypes/pvptimedchallengeflagreturnmedium": { + "value": "Return the Cephalon" + }, + "/lotus/pvpchallengetypes/pvptimedchallengegamemodecomplete": { + "value": "Finish a match" + }, + "/lotus/pvpchallengetypes/pvptimedchallengegamemodewins": { + "value": "Win a timed match" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillscomboeasy": { + "value": "Get an enemy kill combo" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillscombohard": { + "value": "Get an enemy kill combo" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillscombomedium": { + "value": "Get an enemy kill combo" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsheadshotseasy": { + "value": "Kill your enemies with headshots" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsheadshotshard": { + "value": "Kill your enemies with headshots" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsheadshotsmedium": { + "value": "Kill your enemies with headshots" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsmeleeeasy": { + "value": "Kill enemies with melee" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsmeleehard": { + "value": "Kill enemies with melee" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsmeleemedium": { + "value": "Kill enemies with melee" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsmultieasy": { + "value": "Get a multi-enemy killstreak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsmultihard": { + "value": "Get a multi-enemy killstreak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsmultimedium": { + "value": "Get a multi-enemy killstreak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillspayback_easy": { + "value": "Get revenge" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillspayback_hard": { + "value": "Get revenge" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillspayback_medium": { + "value": "Get revenge" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillspaybackeasy": { + "value": "Get revenge" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillspaybackhard": { + "value": "Get revenge" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillspaybackmedium": { + "value": "Get revenge" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillspowereasy": { + "value": "Kill enemies fast" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillspowerhard": { + "value": "Kill enemies fast" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillspowermedium": { + "value": "Kill enemies fast" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsprimaryeasy": { + "value": "Get kills with your primary" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsprimaryhard": { + "value": "Get kills with your primary" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsprimarymedium": { + "value": "Get kills with your primary" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillssecondaryeasy": { + "value": "Kill enemies with a secondary" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillssecondaryhard": { + "value": "Kill enemies with a secondary" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillssecondarymedium": { + "value": "Kill enemies with a secondary" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreak_easy": { + "value": "Get a killstreak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreak_hard": { + "value": "Get a killstreak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreak_medium": { + "value": "Get a killstreak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakdomination_easy": { + "value": "Dominate with your kill streaks" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakdomination_hard": { + "value": "Dominate with your kill streaks" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakdomination_medium": { + "value": "Dominate with your kill streaks" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakdominationeasy": { + "value": "Get a dominating killstreak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakdominationhard": { + "value": "Get a dominating killstreak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakdominationmedium": { + "value": "Get a dominating killstreak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakeasy": { + "value": "Get a kill streak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakhard": { + "value": "Get a kill streak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakmedium": { + "value": "Get a kill streak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakstopped_easy": { + "value": "Stop a kill Streak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakstopped_hard": { + "value": "Stop a kill Streak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakstopped_medium": { + "value": "Stop a kill Streak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakstoppedeasy": { + "value": "Stop a killstreak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakstoppedhard": { + "value": "Stop a killstreak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillsstreakstoppedmedium": { + "value": "Stop a killstreak" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillstargetinaireasy": { + "value": "Kill enemies in the air" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillstargetinairhard": { + "value": "Kill enemies in the air" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillstargetinairmedium": { + "value": "Kill enemies in the air" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillswhileinaireasy": { + "value": "Kill enemies while in the air" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillswhileinairhard": { + "value": "Kill enemies while in the air" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillswhileinairmedium": { + "value": "Kill enemies while in the air" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillswhileslidingeasy": { + "value": "Kill enemies while sliding" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillswhileslidinghard": { + "value": "Kill enemies while sliding" + }, + "/lotus/pvpchallengetypes/pvptimedchallengekillswhileslidingmedium": { + "value": "Kill enemies while sliding" + }, + "/lotus/pvpchallengetypes/pvptimedchallengematchcompleteeasy": { + "value": "Win a timed match" + }, + "/lotus/pvpchallengetypes/pvptimedchallengematchcompletehard": { + "value": "Win a timed match" + }, + "/lotus/pvpchallengetypes/pvptimedchallengematchcompletemedium": { + "value": "Win a timed match" + }, + "/lotus/pvpchallengetypes/pvptimedchallengeotherchallengecompleteany": { + "value": "Finish a challenge" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballcatcheseasy": { + "value": "Catch the Lunaro" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballcatcheshard": { + "value": "Catch the Lunaro" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballcatchesmedium": { + "value": "Catch the Lunaro" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballcheckseasy": { + "value": "Check another player" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballcheckshard": { + "value": "Check another player" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballchecksmedium": { + "value": "Check another player" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballgoalseasy": { + "value": "Score goals" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballgoalshard": { + "value": "Score goals" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballgoalsmedium": { + "value": "Score goals" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballinterceptionseasy": { + "value": "Intercept passes from an enemy" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballinterceptionshard": { + "value": "Intercept passes from an enemy" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballinterceptionsmedium": { + "value": "Intercept passes from an enemy" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballpasseseasy": { + "value": "Make a successful Lunaro pass" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballpasseshard": { + "value": "Make a successful Lunaro pass" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballpassesmedium": { + "value": "Make a successful Lunaro pass" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballstealseasy": { + "value": "Steal the Lunaro" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballstealshard": { + "value": "Steal the Lunaro" + }, + "/lotus/pvpchallengetypes/pvptimedchallengespeedballstealsmedium": { + "value": "Steal the Lunaro" + }, + "/lotus/pvpchallengetypes/pvptimedchallengeweeklystandardset": { + "value": "the standard set of weekly challenges" + }, + "/lotus/storeitems/animations/flightsuit/testmeleeattacks/testspacesword": { + "value": "Imspartacus" + }, + "/lotus/storeitems/levels/minigames/sentinel/enemies/bullethell/heliosbosspowersuit": { + "value": "Helios" + }, + "/lotus/storeitems/levels/minigames/sentinel/sentinelgametestsuit": { + "value": "Wyrm" + }, + "/lotus/storeitems/levels/minigames/sentinel/spaceinvaders/defenderpowersuiti": { + "value": "Djinn" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/autoturretweapon": { + "value": "Mk1-braton" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/autoturretweaponii": { + "value": "Mk1-braton" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/burstlaseri": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/burstlaserii": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/burstlaseriii": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/burstlaseriv": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/burstlaserv": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/droneriflei": { + "value": "Assault Rifle" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/dronerifleii": { + "value": "Assault Rifle" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/dronerifleiii": { + "value": "Assault Rifle" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/elitespacemanrifle": { + "value": "Mk1-braton" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/grineermarinerifle": { + "value": "Mk1-braton" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/grineermarinerocketlauncher": { + "value": "Any" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/heliosbosscrategun": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/heliosbossprojectilewall": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/heliosbosssniper": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/heliosbossspraygun": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/heliosbosstargetergun": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/kubrowminibossballgun": { + "value": "Mk1-braton" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/kubrowminibossbladegun": { + "value": "Mk1-braton" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/kubrowminibossrocketlauncher": { + "value": "Any" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/kubrowminibosssniper": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/kubrowminibossspraygun": { + "value": "Mk1-braton" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/rocketlaseri": { + "value": "Any" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/rocketlaserii": { + "value": "Any" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/rocketlaseriii": { + "value": "Any" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/rocketlauncheri": { + "value": "Any" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/rocketlauncherii": { + "value": "Any" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/rocketlauncheriii": { + "value": "Any" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/sniperlaseri": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/sniperlaserii": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/sniperlaseriii": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/sniperriflei": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/sniperrifleii": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/sniperrifleiii": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/sniperrocketi": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/sniperrocketii": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/sniperrocketiii": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/sniperrocketlaseri": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/sniperrocketlaserii": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/sniperrocketlaseriii": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/twodimburstlaseri": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/twodimburstlaserii": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/twodimrocketlauncheri": { + "value": "Any" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/twodimrocketlauncherii": { + "value": "Any" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/twodimsniperriflei": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/bullethell/twodimsniperrifleii": { + "value": "Kraken" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/radiosets/twodimradiosetsweapon": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/radiosets/twodimufoweapon": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/radiosets/ufoweaponrandomfire": { + "value": "Burst Laser" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/spaceinvaders/bluespaceinvadergun": { + "value": "Assault Rifle" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/spaceinvaders/defenderweapon": { + "value": "Assault Rifle" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/spaceinvaders/greenspaceinvadergun": { + "value": "Assault Rifle" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/spaceinvaders/redspaceinvadergun": { + "value": "Assault Rifle" + }, + "/lotus/storeitems/levels/minigames/sentinel/weapons/spaceinvaders/spaceinvadergun": { + "value": "Assault Rifle" + }, + "/lotus/storeitems/levels/minigames/sentinel/wyrmpowersuit": { + "value": "Wyrm" + }, + "/lotus/storeitems/levels/sectorwars/placeabledecos/pvpspectrespawnerrecipe": { + "value": "Specter Transporter" + }, + "/lotus/storeitems/levels/sectorwars/placeabledecos/pvpturretdecorecipe": { + "value": "Fu-jin Cannon " + }, + "/lotus/storeitems/levels/sectorwars/placeabledecos/pvpturretvariantadecorecipe": { + "value": "Rai-jin Cannon " + }, + "/lotus/storeitems/levels/sectorwars/placeabledecos/pvpturretvariantbdecorecipe": { + "value": "Su-jin" + }, + "/lotus/storeitems/levels/sectorwars/placeabledecos/pvpturretvariantcdecorecipe": { + "value": "Do-jin" + }, + "/lotus/storeitems/powersuits/all/carryabilitycard": { + "value": "Void Carry" + }, + "/lotus/storeitems/powersuits/all/clothtestsuit": { + "value": "Mesa" + }, + "/lotus/storeitems/powersuits/all/lureabilitycard": { + "value": "Void Lure" + }, + "/lotus/storeitems/powersuits/all/repelabilitycard": { + "value": "Repel" + }, + "/lotus/storeitems/powersuits/all/returnabilitycard": { + "value": "Deja Vu" + }, + "/lotus/storeitems/powersuits/all/teaminvisibilityabilitycard": { + "value": "Invisibility" + }, + "/lotus/storeitems/powersuits/antimatter/anti": { + "value": "Nova" + }, + "/lotus/storeitems/powersuits/antimatter/antimatterdropabilitycard": { + "value": "Antimatter Drop" + }, + "/lotus/storeitems/powersuits/antimatter/antimatterdropaugmentcard": { + "value": "Antimatter Absorb" + }, + "/lotus/storeitems/powersuits/antimatter/molecularprimeabilitycard": { + "value": "Molecular Prime" + }, + "/lotus/storeitems/powersuits/antimatter/novaprime": { + "value": "Nova Prime" + }, + "/lotus/storeitems/powersuits/antimatter/nullstarabilitycard": { + "value": "Null Star" + }, + "/lotus/storeitems/powersuits/antimatter/nullstaraugmentcard": { + "value": "Neutron Star" + }, + "/lotus/storeitems/powersuits/antimatter/wormholeabilitycard": { + "value": "Worm Hole" + }, + "/lotus/storeitems/powersuits/antimatter/wormholeaugmentcard": { + "value": "Escape Velocity" + }, + "/lotus/storeitems/powersuits/archwing/demolitionjetpack/artillerybarrageabilitycard": { + "value": "Thumper" + }, + "/lotus/storeitems/powersuits/archwing/demolitionjetpack/bigboyabilitycard": { + "value": "Warhead" + }, + "/lotus/storeitems/powersuits/archwing/demolitionjetpack/demolitionjetpack": { + "value": "Elytron" + }, + "/lotus/storeitems/powersuits/archwing/demolitionjetpack/exhausttrailabilitycard": { + "value": "Core Vent" + }, + "/lotus/storeitems/powersuits/archwing/demolitionjetpack/tntabilitycard": { + "value": "Bloomer" + }, + "/lotus/storeitems/powersuits/archwing/primejetpack/primejetpack": { + "value": "Odonata Prime" + }, + "/lotus/storeitems/powersuits/archwing/standardjetpack/emppushabilitycard": { + "value": "Repel" + }, + "/lotus/storeitems/powersuits/archwing/standardjetpack/fireshieldabilitycard": { + "value": "Energy Shell" + }, + "/lotus/storeitems/powersuits/archwing/standardjetpack/flarecountermeasureabilitycard": { + "value": "Disarray" + }, + "/lotus/storeitems/powersuits/archwing/standardjetpack/missilevolleyabilitycard": { + "value": "Seeking Fire" + }, + "/lotus/storeitems/powersuits/archwing/standardjetpack/standardjetpack": { + "value": "Odonata" + }, + "/lotus/storeitems/powersuits/archwing/stealthjetpack/blinkabilitycard": { + "value": "Blink" + }, + "/lotus/storeitems/powersuits/archwing/stealthjetpack/cloakabilitycard": { + "value": "Penumbra" + }, + "/lotus/storeitems/powersuits/archwing/stealthjetpack/distractiondronesabilitycard": { + "value": "Fighter Escort" + }, + "/lotus/storeitems/powersuits/archwing/stealthjetpack/gravinstabilityabilitycard": { + "value": "Cosmic Crush" + }, + "/lotus/storeitems/powersuits/archwing/stealthjetpack/stealthjetpack": { + "value": "Itzal" + }, + "/lotus/storeitems/powersuits/banshee/banshee": { + "value": "Banshee" + }, + "/lotus/storeitems/powersuits/banshee/pushabilitycard": { + "value": "Sonic Boom" + }, + "/lotus/storeitems/powersuits/banshee/pushaugmentcard": { + "value": "Sonic Fracture" + }, + "/lotus/storeitems/powersuits/banshee/silenceabilitycard": { + "value": "Silence" + }, + "/lotus/storeitems/powersuits/banshee/silenceaugmentcard": { + "value": "Savage Silence" + }, + "/lotus/storeitems/powersuits/banshee/sonarabilitycard": { + "value": "Sonar" + }, + "/lotus/storeitems/powersuits/banshee/sonaraugmentcard": { + "value": "Resonance" + }, + "/lotus/storeitems/powersuits/berserker/berserker": { + "value": "Valkyr" + }, + "/lotus/storeitems/powersuits/berserker/grappleabilitycard": { + "value": "Rip Line" + }, + "/lotus/storeitems/powersuits/berserker/grappleaugmentcard": { + "value": "Swing Line" + }, + "/lotus/storeitems/powersuits/berserker/intimidateabilitycard": { + "value": "Warcry" + }, + "/lotus/storeitems/powersuits/berserker/intimidateaugmentcard": { + "value": "Eternal War" + }, + "/lotus/storeitems/powersuits/berserker/laststandabilitycard": { + "value": "Hysteria" + }, + "/lotus/storeitems/powersuits/berserker/laststandpvpaugmentcard": { + "value": "Hysterical Fixation" + }, + "/lotus/storeitems/powersuits/berserker/shieldbashaugmentcard": { + "value": "Prolonged Paralysis" + }, + "/lotus/storeitems/powersuits/berserker/shieldblastabilitycard": { + "value": "Paralysis" + }, + "/lotus/storeitems/powersuits/cowgirl/ballisticbatteryabilitycard": { + "value": "Ballistic Battery" + }, + "/lotus/storeitems/powersuits/cowgirl/ballisticbatteryaugmentcard": { + "value": "Ballistic Bullseye" + }, + "/lotus/storeitems/powersuits/cowgirl/cowgirl": { + "value": "Mesa" + }, + "/lotus/storeitems/powersuits/cowgirl/cowgirlnpc": { + "value": "Mesa" + }, + "/lotus/storeitems/powersuits/cowgirl/gunfuabilitycard": { + "value": "Peacemaker" + }, + "/lotus/storeitems/powersuits/cowgirl/ricochetarmourabilitycard": { + "value": "Shatter Shield" + }, + "/lotus/storeitems/powersuits/cowgirl/ricochetarmouraugmentcard": { + "value": "Staggering Shield" + }, + "/lotus/storeitems/powersuits/cowgirl/russianrouletteabilitycard": { + "value": "Shooting Gallery" + }, + "/lotus/storeitems/powersuits/cowgirl/russianrouletteaugmentcard": { + "value": "Muzzle Flash" + }, + "/lotus/storeitems/powersuits/dragon/dragon": { + "value": "Chroma" + }, + "/lotus/storeitems/powersuits/dragon/dragonbreathaugmentcard": { + "value": "Afterburn" + }, + "/lotus/storeitems/powersuits/dragon/dragonluckaugmentcard": { + "value": "Everlasting Ward" + }, + "/lotus/storeitems/powersuits/dragon/dragonnpcpowersuit": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/powersuits/dragon/dragonscalesaugmentcard": { + "value": "Vexing Retaliation" + }, + "/lotus/storeitems/powersuits/ember/ember": { + "value": "Ember" + }, + "/lotus/storeitems/powersuits/ember/emberprime": { + "value": "Ember Prime" + }, + "/lotus/storeitems/powersuits/ember/fireballabilitycard": { + "value": "Fireball" + }, + "/lotus/storeitems/powersuits/ember/fireballaugmentcard": { + "value": "Fireball Frenzy" + }, + "/lotus/storeitems/powersuits/ember/fireblastabilitycard": { + "value": "Fire Blast" + }, + "/lotus/storeitems/powersuits/ember/fireblastaugmentcard": { + "value": "Fire Fright" + }, + "/lotus/storeitems/powersuits/ember/fireblastpvpaugmentcard": { + "value": "Purifying Flames" + }, + "/lotus/storeitems/powersuits/ember/fireskinabilitycard": { + "value": "Accelerant" + }, + "/lotus/storeitems/powersuits/ember/worldonfireabilitycard": { + "value": "World On Fire" + }, + "/lotus/storeitems/powersuits/ember/worldonfireaugmentcard": { + "value": "Firequake" + }, + "/lotus/storeitems/powersuits/excalibur/excalibur": { + "value": "Excalibur" + }, + "/lotus/storeitems/powersuits/excalibur/excaliburprime": { + "value": "Excalibur Prime" + }, + "/lotus/storeitems/powersuits/excalibur/radialblindabilitycard": { + "value": "Radial Blind" + }, + "/lotus/storeitems/powersuits/excalibur/radialblindaugmentcard": { + "value": "Radiant Finish" + }, + "/lotus/storeitems/powersuits/excalibur/radialblindpvpaugmentcard": { + "value": "Signal Flare" + }, + "/lotus/storeitems/powersuits/excalibur/radialjavelinabilitycard": { + "value": "Radial Javelin" + }, + "/lotus/storeitems/powersuits/excalibur/radialjavelinaugmentcard": { + "value": "Furious Javelin" + }, + "/lotus/storeitems/powersuits/excalibur/slashdashabilitycard": { + "value": "Slash Dash" + }, + "/lotus/storeitems/powersuits/excalibur/slashdashaugmentcard": { + "value": "Surging Dash" + }, + "/lotus/storeitems/powersuits/excalibur/slashdashpvpaugmentcard": { + "value": "Purging Slash" + }, + "/lotus/storeitems/powersuits/excalibur/superjumpabilitycard": { + "value": "Super Jump" + }, + "/lotus/storeitems/powersuits/frost/avalancheabilitycard": { + "value": "Avalanche" + }, + "/lotus/storeitems/powersuits/frost/frost": { + "value": "Frost" + }, + "/lotus/storeitems/powersuits/frost/frostprime": { + "value": "Frost Prime" + }, + "/lotus/storeitems/powersuits/frost/iceshieldabilitycard": { + "value": "Snow Globe" + }, + "/lotus/storeitems/powersuits/frost/iceshieldaugmentcard": { + "value": "Chilling Globe" + }, + "/lotus/storeitems/powersuits/frost/icespikeabilitycard": { + "value": "Ice Wave" + }, + "/lotus/storeitems/powersuits/frost/icespikeaugmentcard": { + "value": "Ice Wave Impedance" + }, + "/lotus/storeitems/powersuits/frost/icicleabilitycard": { + "value": "Freeze" + }, + "/lotus/storeitems/powersuits/frost/icicleaugmentcard": { + "value": "Freeze Force" + }, + "/lotus/storeitems/powersuits/harlequin/harlequin": { + "value": "Mirage" + }, + "/lotus/storeitems/powersuits/harlequin/illusionabilitycard": { + "value": "Hall Of Mirrors" + }, + "/lotus/storeitems/powersuits/harlequin/illusionaugmentcard": { + "value": "Hall Of Malevolence" + }, + "/lotus/storeitems/powersuits/harlequin/lightabilitycard": { + "value": "Eclipse" + }, + "/lotus/storeitems/powersuits/harlequin/lightaugmentcard": { + "value": "Total Eclipse" + }, + "/lotus/storeitems/powersuits/harlequin/objectchangeabilitycard": { + "value": "Sleight Of Hand" + }, + "/lotus/storeitems/powersuits/harlequin/objectchangeaugmentcard": { + "value": "Explosive Legerdemain" + }, + "/lotus/storeitems/powersuits/harlequin/prismabilitycard": { + "value": "Prism" + }, + "/lotus/storeitems/powersuits/jade/chaosabilitycard": { + "value": "Chaos" + }, + "/lotus/storeitems/powersuits/jade/chaosaugmentcard": { + "value": "Chaos Sphere" + }, + "/lotus/storeitems/powersuits/jade/daggerabilitycard": { + "value": "Psychic Bolts" + }, + "/lotus/storeitems/powersuits/jade/daggeraugmentcard": { + "value": "Pacifying Bolts" + }, + "/lotus/storeitems/powersuits/jade/jade": { + "value": "Nyx" + }, + "/lotus/storeitems/powersuits/jade/mindcontrolabilitycard": { + "value": "Mind Control" + }, + "/lotus/storeitems/powersuits/jade/mindcontrolaugmentcard": { + "value": "Mind Freak" + }, + "/lotus/storeitems/powersuits/jade/nyxprime": { + "value": "Nyx Prime" + }, + "/lotus/storeitems/powersuits/jade/selfbulletattractorabilitycard": { + "value": "Absorb" + }, + "/lotus/storeitems/powersuits/jade/selfbulletattractorpvpaugmentcard": { + "value": "Singularity" + }, + "/lotus/storeitems/powersuits/loki/decoyabilitycard": { + "value": "Decoy" + }, + "/lotus/storeitems/powersuits/loki/disarmabilitycard": { + "value": "Radial Disarm" + }, + "/lotus/storeitems/powersuits/loki/disarmaugmentcard": { + "value": "Irradiating Disarm" + }, + "/lotus/storeitems/powersuits/loki/invisibilityabilitycard": { + "value": "Invisibility" + }, + "/lotus/storeitems/powersuits/loki/invisibilityaugmentcard": { + "value": "Hushed Invisibility" + }, + "/lotus/storeitems/powersuits/loki/loki": { + "value": "Loki" + }, + "/lotus/storeitems/powersuits/loki/lokiprime": { + "value": "Loki Prime" + }, + "/lotus/storeitems/powersuits/loki/switchabilitycard": { + "value": "Switch Teleport" + }, + "/lotus/storeitems/powersuits/loki/switchaugmentcard": { + "value": "Safeguard Switch" + }, + "/lotus/storeitems/powersuits/mag/bulletattractorabilitycard": { + "value": "Magnetize" + }, + "/lotus/storeitems/powersuits/mag/bulletattractoraugmentcard": { + "value": "[Placeholder] Magnetize Augment" + }, + "/lotus/storeitems/powersuits/mag/crushabilitycard": { + "value": "Crush" + }, + "/lotus/storeitems/powersuits/mag/crushaugmentcard": { + "value": "Fracturing Crush" + }, + "/lotus/storeitems/powersuits/mag/mag": { + "value": "Mag" + }, + "/lotus/storeitems/powersuits/mag/magprime": { + "value": "Mag Prime" + }, + "/lotus/storeitems/powersuits/mag/pullabilitycard": { + "value": "Pull" + }, + "/lotus/storeitems/powersuits/mag/pullaugmentcard": { + "value": "Greedy Pull" + }, + "/lotus/storeitems/powersuits/mag/pullpvpaugmentcard": { + "value": "Sapping Reach" + }, + "/lotus/storeitems/powersuits/mag/shieldregenabilitycard": { + "value": "Polarize" + }, + "/lotus/storeitems/powersuits/mag/shieldregenaugmentcard": { + "value": "Shield Transference" + }, + "/lotus/storeitems/powersuits/mag/shieldregenpvpaugmentcard": { + "value": "Shield Overload" + }, + "/lotus/storeitems/powersuits/magician/banishabilitycard": { + "value": "Banish" + }, + "/lotus/storeitems/powersuits/magician/banishaugmentcard": { + "value": "Haven" + }, + "/lotus/storeitems/powersuits/magician/magician": { + "value": "Limbo" + }, + "/lotus/storeitems/powersuits/magician/riftwalkabilitycard": { + "value": "Rift Walk" + }, + "/lotus/storeitems/powersuits/magician/tearinspaceabilitycard": { + "value": "Cataclysm" + }, + "/lotus/storeitems/powersuits/magician/tearinspaceaugmentcard": { + "value": "Cataclysmic Continuum" + }, + "/lotus/storeitems/powersuits/magician/volatileabilitycard": { + "value": "Rift Surge" + }, + "/lotus/storeitems/powersuits/magician/volatileaugmentcard": { + "value": "Rift Torrent" + }, + "/lotus/storeitems/powersuits/monkeyking/monkeyking": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/powersuits/necro/clonethedeadabilitycard": { + "value": "Shadows Of The Dead" + }, + "/lotus/storeitems/powersuits/necro/clonethedeadaugmentcard": { + "value": "Shield Of Shadows" + }, + "/lotus/storeitems/powersuits/necro/necro": { + "value": "Nekros" + }, + "/lotus/storeitems/powersuits/necro/searchthedeadabilitycard": { + "value": "Desecrate" + }, + "/lotus/storeitems/powersuits/necro/searchthedeadaugmentcard": { + "value": "Despoil" + }, + "/lotus/storeitems/powersuits/necro/soulpunchabilitycard": { + "value": "Soul Punch" + }, + "/lotus/storeitems/powersuits/necro/soulpunchaugmentcard": { + "value": "Soul Survivor" + }, + "/lotus/storeitems/powersuits/necro/terrortotemabilitycard": { + "value": "Terrify" + }, + "/lotus/storeitems/powersuits/ninja/ashprime": { + "value": "Ash Prime" + }, + "/lotus/storeitems/powersuits/ninja/glaiveabilitycard": { + "value": "Shuriken" + }, + "/lotus/storeitems/powersuits/ninja/glaiveaugmentcard": { + "value": "Seeking Shuriken" + }, + "/lotus/storeitems/powersuits/ninja/ninja": { + "value": "Ash" + }, + "/lotus/storeitems/powersuits/ninja/ninjastormabilitycard": { + "value": "Blade Storm" + }, + "/lotus/storeitems/powersuits/ninja/ninjastormaugmentcard": { + "value": "Rising Storm" + }, + "/lotus/storeitems/powersuits/ninja/smokescreenabilitycard": { + "value": "Smoke Screen" + }, + "/lotus/storeitems/powersuits/ninja/smokescreenaugmentcard": { + "value": "Smoke Shadow" + }, + "/lotus/storeitems/powersuits/ninja/smokescreenpvpaugmentcard": { + "value": "Tear Gas" + }, + "/lotus/storeitems/powersuits/ninja/telelporttoabilitycard": { + "value": "Teleport" + }, + "/lotus/storeitems/powersuits/paladin/paladin": { + "value": "Oberon" + }, + "/lotus/storeitems/powersuits/paladin/reckoningabilitycard": { + "value": "Reckoning" + }, + "/lotus/storeitems/powersuits/paladin/reckoningaugmentcard": { + "value": "Hallowed Reckoning" + }, + "/lotus/storeitems/powersuits/paladin/reckoningpvpaugmentcard": { + "value": "Defiled Reckoning" + }, + "/lotus/storeitems/powersuits/paladin/smiteabilitycard": { + "value": "Smite" + }, + "/lotus/storeitems/powersuits/paladin/smiteaugmentcard": { + "value": "Smite Infusion" + }, + "/lotus/storeitems/powersuits/paladin/stairwaytoheavenabilitycard": { + "value": "Hallowed Ground" + }, + "/lotus/storeitems/powersuits/paladin/stairwaytoheavenaugmentcard": { + "value": "Hallowed Eruption" + }, + "/lotus/storeitems/powersuits/pirate/cannonbarrageabilitycard": { + "value": "Tempest Barrage" + }, + "/lotus/storeitems/powersuits/pirate/krakenabilitycard": { + "value": "Tentacle Swarm" + }, + "/lotus/storeitems/powersuits/pirate/krakenaugmentcard": { + "value": "Pilfering Swarm" + }, + "/lotus/storeitems/powersuits/pirate/liquifyabilitycard": { + "value": "Undertow" + }, + "/lotus/storeitems/powersuits/pirate/liquifyaugmentcard": { + "value": "Curative Undertow" + }, + "/lotus/storeitems/powersuits/pirate/pirate": { + "value": "Hydroid" + }, + "/lotus/storeitems/powersuits/pirate/tidalwaveabilitycard": { + "value": "Tidal Surge" + }, + "/lotus/storeitems/powersuits/pirate/tidalwaveaugmentcard": { + "value": "Tidal Impunity" + }, + "/lotus/storeitems/powersuits/powersuitabilities/radialblastabilitycard": { + "value": "Radial Blast" + }, + "/lotus/storeitems/powersuits/rhino/ironskinabilitycard": { + "value": "Iron Skin" + }, + "/lotus/storeitems/powersuits/rhino/ironskinaugmentcard": { + "value": "Iron Shrapnel" + }, + "/lotus/storeitems/powersuits/rhino/radialblastabilitycard": { + "value": "Roar" + }, + "/lotus/storeitems/powersuits/rhino/radialblastaugmentcard": { + "value": "Piercing Roar" + }, + "/lotus/storeitems/powersuits/rhino/rhino": { + "value": "Rhino" + }, + "/lotus/storeitems/powersuits/rhino/rhinochargeabilitycard": { + "value": "Rhino Charge" + }, + "/lotus/storeitems/powersuits/rhino/rhinochargeaugmentcard": { + "value": "Ironclad Charge" + }, + "/lotus/storeitems/powersuits/rhino/rhinoprime": { + "value": "Rhino Prime" + }, + "/lotus/storeitems/powersuits/rhino/rhinostompabilitycard": { + "value": "Rhino Stomp" + }, + "/lotus/storeitems/powersuits/saryn/explosivedissolveabilitycard": { + "value": "Miasma" + }, + "/lotus/storeitems/powersuits/saryn/poisonabilitycard": { + "value": "Spores" + }, + "/lotus/storeitems/powersuits/saryn/poisonaugmentcard": { + "value": "Venom Dose" + }, + "/lotus/storeitems/powersuits/saryn/saryn": { + "value": "Saryn" + }, + "/lotus/storeitems/powersuits/saryn/shedabilitycard": { + "value": "Molt" + }, + "/lotus/storeitems/powersuits/saryn/shedaugmentcard": { + "value": "Regenerative Molt" + }, + "/lotus/storeitems/powersuits/saryn/weaponpoisonabilitycard": { + "value": "Toxic Lash" + }, + "/lotus/storeitems/powersuits/saryn/weaponpoisonaugmentcard": { + "value": "Contagion Cloud" + }, + "/lotus/storeitems/powersuits/tengu/divebombabilitycard": { + "value": "Dive Bomb" + }, + "/lotus/storeitems/powersuits/tengu/divebombaugmentcard": { + "value": "Divebomb Vortex" + }, + "/lotus/storeitems/powersuits/tengu/tailwindabilitycard": { + "value": "Tail Wind" + }, + "/lotus/storeitems/powersuits/tengu/tengu": { + "value": "Zephyr" + }, + "/lotus/storeitems/powersuits/tengu/tornadoabilitycard": { + "value": "Tornado" + }, + "/lotus/storeitems/powersuits/tengu/tornadoaugmentcard": { + "value": "Funnel Clouds" + }, + "/lotus/storeitems/powersuits/tengu/turbulenceabilitycard": { + "value": "Turbulence" + }, + "/lotus/storeitems/powersuits/tengu/turbulenceaugmentcard": { + "value": "Jet Stream" + }, + "/lotus/storeitems/powersuits/trapper/levtrapabilitycard": { + "value": "Bastille" + }, + "/lotus/storeitems/powersuits/trapper/levtrapaugmentcard": { + "value": "Repelling Bastille" + }, + "/lotus/storeitems/powersuits/trapper/magholeabilitycard": { + "value": "Vortex" + }, + "/lotus/storeitems/powersuits/trapper/magholeaugmentcard": { + "value": "Perpetual Vortex" + }, + "/lotus/storeitems/powersuits/trapper/trapper": { + "value": "Vauban" + }, + "/lotus/storeitems/powersuits/trapper/zaptrapabilitycard": { + "value": "Tesla" + }, + "/lotus/storeitems/powersuits/trapper/zaptrapaugmentcard": { + "value": "Tesla Link" + }, + "/lotus/storeitems/powersuits/trinity/blessingabilitycard": { + "value": "Blessing" + }, + "/lotus/storeitems/powersuits/trinity/energyvampireabilitycard": { + "value": "Energy Vampire" + }, + "/lotus/storeitems/powersuits/trinity/energyvampireaugmentcard": { + "value": "Vampire Leech" + }, + "/lotus/storeitems/powersuits/trinity/linkabilitycard": { + "value": "Link" + }, + "/lotus/storeitems/powersuits/trinity/linkaugmentcard": { + "value": "Abating Link" + }, + "/lotus/storeitems/powersuits/trinity/trinity": { + "value": "Trinity" + }, + "/lotus/storeitems/powersuits/trinity/welloflifeabilitycard": { + "value": "Well Of Life" + }, + "/lotus/storeitems/powersuits/trinity/welloflifeaugmentcard": { + "value": "Pool Of Life" + }, + "/lotus/storeitems/powersuits/volt/overloadabilitycard": { + "value": "Discharge" + }, + "/lotus/storeitems/powersuits/volt/overloadaugmentcard": { + "value": "Capacitance" + }, + "/lotus/storeitems/powersuits/volt/shieldabilitycard": { + "value": "Electric Shield" + }, + "/lotus/storeitems/powersuits/volt/shieldpvpaugmentcard": { + "value": "Recharge Barrier" + }, + "/lotus/storeitems/powersuits/volt/shockabilitycard": { + "value": "Shock" + }, + "/lotus/storeitems/powersuits/volt/shockaugmentcard": { + "value": "Shock Trooper" + }, + "/lotus/storeitems/powersuits/volt/speedabilitycard": { + "value": "Speed" + }, + "/lotus/storeitems/powersuits/volt/speedaugmentcard": { + "value": "Shocking Speed" + }, + "/lotus/storeitems/powersuits/volt/speedpvpaugmentcard": { + "value": "Kinetic Collision" + }, + "/lotus/storeitems/powersuits/volt/volt": { + "value": "Volt" + }, + "/lotus/storeitems/powersuits/volt/voltprime": { + "value": "Volt Prime" + }, + "/lotus/storeitems/quests/theorionblade/orionbladeitem": { + "value": "Dark Dagger" + }, + "/lotus/storeitems/types/boosterpacks/commonartifactpack": { + "value": "Hawk Mod Pack" + }, + "/lotus/storeitems/types/boosterpacks/commonfusionpack": { + "value": "Bronze Fusion Pack" + }, + "/lotus/storeitems/types/boosterpacks/modfuserresult": { + "value": "Mod Fuser" + }, + "/lotus/storeitems/types/boosterpacks/premiumrareartifactpack": { + "value": "Dragon Mod Pack" + }, + "/lotus/storeitems/types/boosterpacks/premiumrarefusionpack": { + "value": "Gold Fusion Pack" + }, + "/lotus/storeitems/types/boosterpacks/premiumuncommonartifactpack": { + "value": "Phoenix Mod Pack" + }, + "/lotus/storeitems/types/boosterpacks/premiumuncommonfusionpack": { + "value": "Silver Fusion Pack" + }, + "/lotus/storeitems/types/boosterpacks/randomkey": { + "value": "Void Key Pack" + }, + "/lotus/storeitems/types/boosterpacks/rareartifactpack": { + "value": "Eagle Mod Pack" + }, + "/lotus/storeitems/types/boosterpacks/rarefusionpack": { + "value": "Wolf Fusion Pack" + }, + "/lotus/storeitems/types/boosterpacks/singlecommonartifact": { + "value": "Eagle Mod Pack" + }, + "/lotus/storeitems/types/boosterpacks/singlerareartifact": { + "value": "Eagle Mod Pack" + }, + "/lotus/storeitems/types/boosterpacks/stancemodpack": { + "value": "Stance Mod Pack" + }, + "/lotus/storeitems/types/boosterpacks/syndicaterandomkey": { + "value": "Void Key Pack" + }, + "/lotus/storeitems/types/boosterpacks/transmutepack": { + "value": "Transmute Core Pack" + }, + "/lotus/storeitems/types/boosterpacks/uncommonartifactpack": { + "value": "Falcon Mod Pack" + }, + "/lotus/storeitems/types/boosterpacks/uncommonfusionpack": { + "value": "Fox Fusion Pack" + }, + "/lotus/storeitems/types/enemies/corpus/quadrobot/miniboss/miniquadshielddroneauramod": { + "value": "Shield Disruption" + }, + "/lotus/storeitems/types/enemies/corpus/vip/infestedaladv/aladvinfquantarifle": { + "value": "Paracyst" + }, + "/lotus/storeitems/types/enemies/sector/rifleweapon": { + "value": "Latron" + }, + "/lotus/storeitems/types/enemies/tennoreplicants/gunslingerpistolslotusweapon": { + "value": "Any" + }, + "/lotus/storeitems/types/friendly/pets/kubrowpetprecepts/kubrowchargeprecept": { + "value": "Hunt" + }, + "/lotus/storeitems/types/friendly/pets/kubrowpetprecepts/kubrowcloakprecept": { + "value": "Stalk" + }, + "/lotus/storeitems/types/friendly/pets/kubrowpetprecepts/kubrowdigprecept": { + "value": "Dig" + }, + "/lotus/storeitems/types/friendly/pets/kubrowpetprecepts/kubrowfearprecept": { + "value": "Howl" + }, + "/lotus/storeitems/types/friendly/pets/kubrowpetprecepts/kubrowsanctuary": { + "value": "Shelter" + }, + "/lotus/storeitems/types/friendly/pets/kubrowpetprecepts/kubrowshieldprecept": { + "value": "Protect" + }, + "/lotus/storeitems/types/friendly/pets/kubrowpetprecepts/kubrowthiefprecept": { + "value": "Scavenge" + }, + "/lotus/storeitems/types/friendly/pets/kubrowpetprecepts/kubrowvipchaseprecept": { + "value": "Unleashed" + }, + "/lotus/storeitems/types/game/basecosmeticenhancer": { + "value": "Arcane" + }, + "/lotus/storeitems/types/game/kubrowpet/adventurerkubrowpetpowersuit": { + "value": "Sahasa Kubrow" + }, + "/lotus/storeitems/types/game/kubrowpet/blanktraitprint": { + "value": "Genetic Code Template" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormida": { + "value": "Sedna Grey" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormidb": { + "value": "Derelict Black" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormidc": { + "value": "Mars Red" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormidd": { + "value": "Infested Black" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormiddiamond": { + "value": "Star White" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormide": { + "value": "Void Black" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormidf": { + "value": "Darvo Blue" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormidg": { + "value": "Ordis Grey" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormidh": { + "value": "Mercury Brown" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormidi": { + "value": "Eris Black" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormidj": { + "value": "Nova Grey" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormidk": { + "value": "Rhino Brown" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormidliquid": { + "value": "Fomorian Grey" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormundanea": { + "value": "Ash Grey" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormundaneb": { + "value": "Earth Brown" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormundanec": { + "value": "Corpus Grey" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormundaned": { + "value": "Hek Green" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormundanediamond": { + "value": "Ki'Teer Grey" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormundanee": { + "value": "Kril Brown" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormundanef": { + "value": "Gallium Grey" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormundaneg": { + "value": "Grustrag Grey" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormundaneh": { + "value": "Saturn Brown" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormundanei": { + "value": "Arid Brown" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormundanej": { + "value": "Forest Grey" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormundanek": { + "value": "Phobos Brown" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolormundaneliquid": { + "value": "Specter White" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorprimetradermida": { + "value": "Perrin Blue" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorprimetradermundanea": { + "value": "Vaykor White" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorprimetradervibranta": { + "value": "Rakta Red" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorvibranta": { + "value": "Anyo Grey" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorvibrantb": { + "value": "Ambulas Black" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorvibrantc": { + "value": "Shadow Grey" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorvibrantd": { + "value": "Sargas Brown" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorvibrantdiamond": { + "value": "Wyrm Blue" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorvibrante": { + "value": "Jupiter Brown" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorvibrantf": { + "value": "Phorid Red" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorvibrantg": { + "value": "Alad Blue" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorvibranth": { + "value": "Venus Brown" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorvibranti": { + "value": "Lotus Purple" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorvibrantj": { + "value": "Valkyr Brown" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorvibrantk": { + "value": "Mirage Red" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorvibrantliquid": { + "value": "Vandal Blue" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorxmasmida": { + "value": "Lotus White" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorxmasmidb": { + "value": "Jadeleaf Green" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorxmasmundanea": { + "value": "Tenno Red" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorxmasmundaneb": { + "value": "Nova White" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorxmasvibranta": { + "value": "Brokk Brown" + }, + "/lotus/storeitems/types/game/kubrowpet/colors/kubrowpetcolorxmasvibrantb": { + "value": "Trinity Red" + }, + "/lotus/storeitems/types/game/kubrowpet/egghatcher": { + "value": "Incubator Power Core" + }, + "/lotus/storeitems/types/game/kubrowpet/eggs/kubrowegg": { + "value": "Kubrow Egg" + }, + "/lotus/storeitems/types/game/kubrowpet/eggs/kubrowpeteggitem": { + "value": "Kubrow Egg" + }, + "/lotus/storeitems/types/game/kubrowpet/furtivekubrowpetpowersuit": { + "value": "Huras Kubrow" + }, + "/lotus/storeitems/types/game/kubrowpet/guardkubrowpetpowersuit": { + "value": "Raksa Kubrow" + }, + "/lotus/storeitems/types/game/kubrowpet/hunterkubrowpetpowersuit": { + "value": "Sunika Kubrow" + }, + "/lotus/storeitems/types/game/kubrowpet/kubrowpetcollaritem": { + "value": "Nai-zhen Kubrow Collar" + }, + "/lotus/storeitems/types/game/kubrowpet/kubrowpetfood": { + "value": "Dna Stabilizers" + }, + "/lotus/storeitems/types/game/kubrowpet/kubrowpetfoodrecipe": { + "value": "Dna Stabilizers" + }, + "/lotus/storeitems/types/game/kubrowpet/kubrowpetpowersuit": { + "value": "Kubrow" + }, + "/lotus/storeitems/types/game/kubrowpet/kubrowpetrecipe": { + "value": "Kubrow" + }, + "/lotus/storeitems/types/game/kubrowpet/patterns/kubrowpetpatterna": { + "value": "Striped Fur Pattern" + }, + "/lotus/storeitems/types/game/kubrowpet/patterns/kubrowpetpatternb": { + "value": "Patchy Fur Pattern" + }, + "/lotus/storeitems/types/game/kubrowpet/patterns/kubrowpetpatternc": { + "value": "Hound Fur Pattern" + }, + "/lotus/storeitems/types/game/kubrowpet/patterns/kubrowpetpatternd": { + "value": "Domino Fur Pattern" + }, + "/lotus/storeitems/types/game/kubrowpet/patterns/kubrowpetpatterndiamond": { + "value": "Atrox Fur Pattern" + }, + "/lotus/storeitems/types/game/kubrowpet/patterns/kubrowpetpatterne": { + "value": "Merle Fur Pattern" + }, + "/lotus/storeitems/types/game/kubrowpet/patterns/kubrowpetpatternf": { + "value": "Lotus Fur Pattern" + }, + "/lotus/storeitems/types/game/kubrowpet/patterns/kubrowpetpatterng": { + "value": "Mottled Fur Pattern" + }, + "/lotus/storeitems/types/game/kubrowpet/patterns/kubrowpetpatternh": { + "value": "Brindle Fur Pattern" + }, + "/lotus/storeitems/types/game/kubrowpet/patterns/kubrowpetpatterni": { + "value": "Tigrol Fur Pattern" + }, + "/lotus/storeitems/types/game/kubrowpet/patterns/kubrowpetpatternliquid": { + "value": "Arklut Fur Pattern" + }, + "/lotus/storeitems/types/game/kubrowpet/patterns/kubrowpetpatternprimetradera": { + "value": "Nexus Fur Pattern" + }, + "/lotus/storeitems/types/game/kubrowpet/patterns/kubrowpetpatternxmasa": { + "value": "Nart-deer Pattern" + }, + "/lotus/storeitems/types/game/kubrowpet/patterns/kubrowpetpatternxmasb": { + "value": "Nistlebrush Pattern" + }, + "/lotus/storeitems/types/game/kubrowpet/petstasisrecoveryrecipe": { + "value": "Kubrow" + }, + "/lotus/storeitems/types/game/kubrowpet/releasepetrecipe": { + "value": "Genetic Code Template" + }, + "/lotus/storeitems/types/game/lotussuitcustomization": { + "value": "Helmet Or Syandana" + }, + "/lotus/storeitems/types/game/lotusweapon": { + "value": "Any" + }, + "/lotus/storeitems/types/game/lotusweapon2d": { + "value": "Any" + }, + "/lotus/storeitems/types/game/playerflightjetpackitem": { + "value": "Archwing" + }, + "/lotus/storeitems/types/game/playerpowersuit": { + "value": "Warframe" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionabronze": { + "value": "Lith S1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionagold": { + "value": "Lith S1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionaplatinum": { + "value": "Lith S1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionasilver": { + "value": "Lith S1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionbbronze": { + "value": "Lith S2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionbgold": { + "value": "Lith S2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionbplatinum": { + "value": "Lith S2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionbsilver": { + "value": "Lith S2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectioncbronze": { + "value": "Lith F1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectioncgold": { + "value": "Lith F1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectioncplatinum": { + "value": "Lith F1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectioncsilver": { + "value": "Lith F1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectiondbronze": { + "value": "Lith V1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectiondgold": { + "value": "Lith V1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectiondplatinum": { + "value": "Lith V1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectiondsilver": { + "value": "Lith V1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionebronze": { + "value": "Lith F2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionegold": { + "value": "Lith F2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectioneplatinum": { + "value": "Lith F2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionesilver": { + "value": "Lith F2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionfbronze": { + "value": "Lith M1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionfgold": { + "value": "Lith M1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionfplatinum": { + "value": "Lith M1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionfsilver": { + "value": "Lith M1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectiongbronze": { + "value": "Lith A1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionggold": { + "value": "Lith A1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectiongplatinum": { + "value": "Lith A1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectiongsilver": { + "value": "Lith A1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionibronze": { + "value": "Lith S3 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionigold": { + "value": "Lith S3 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectioniplatinum": { + "value": "Lith S3 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionisilver": { + "value": "Lith S3 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionjbronze": { + "value": "Lith C1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionjgold": { + "value": "Lith C1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionjplatinum": { + "value": "Lith C1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionjsilver": { + "value": "Lith C1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionkbronze": { + "value": "Lith K1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionkgold": { + "value": "Lith K1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionkplatinum": { + "value": "Lith K1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionksilver": { + "value": "Lith K1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionlbronze": { + "value": "Lith N1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionlgold": { + "value": "Lith N1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionlplatinum": { + "value": "Lith N1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionlsilver": { + "value": "Lith N1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionmbronze": { + "value": "Lith V2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionmgold": { + "value": "Lith V2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionmplatinum": { + "value": "Lith V2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionmsilver": { + "value": "Lith V2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionnbronze": { + "value": "Lith S4 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionngold": { + "value": "Lith S4 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionnplatinum": { + "value": "Lith S4 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionnsilver": { + "value": "Lith S4 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionobronze": { + "value": "Lith S5 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionogold": { + "value": "Lith S5 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionoplatinum": { + "value": "Lith S5 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionosilver": { + "value": "Lith S5 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionqbronze": { + "value": "Lith G1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionqgold": { + "value": "Lith G1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionqplatinum": { + "value": "Lith G1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionqsilver": { + "value": "Lith G1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionrbronze": { + "value": "Lith N2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionrgold": { + "value": "Lith N2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionrplatinum": { + "value": "Lith N2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionrsilver": { + "value": "Lith N2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionsbronze": { + "value": "Lith V3 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionsgold": { + "value": "Lith V3 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionsplatinum": { + "value": "Lith V3 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t1voidprojectionssilver": { + "value": "Lith V3 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionabronze": { + "value": "Meso D1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionagold": { + "value": "Meso D1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionaplatinum": { + "value": "Meso D1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionasilver": { + "value": "Meso D1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionbbronze": { + "value": "Meso N1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionbgold": { + "value": "Meso N1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionbplatinum": { + "value": "Meso N1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionbsilver": { + "value": "Meso N1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectioncbronze": { + "value": "Meso C1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectioncgold": { + "value": "Meso C1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectioncplatinum": { + "value": "Meso C1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectioncsilver": { + "value": "Meso C1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectiondbronze": { + "value": "Meso V2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectiondgold": { + "value": "Meso V2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectiondplatinum": { + "value": "Meso V2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectiondsilver": { + "value": "Meso V2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionebronze": { + "value": "Meso N2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionegold": { + "value": "Meso N2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectioneplatinum": { + "value": "Meso N2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionesilver": { + "value": "Meso N2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionfbronze": { + "value": "Meso B1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionfgold": { + "value": "Meso B1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionfplatinum": { + "value": "Meso B1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionfsilver": { + "value": "Meso B1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectiongbronze": { + "value": "Meso V1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionggold": { + "value": "Meso V1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectiongplatinum": { + "value": "Meso V1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectiongsilver": { + "value": "Meso V1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionibronze": { + "value": "Meso S1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionigold": { + "value": "Meso S1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectioniplatinum": { + "value": "Meso S1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionisilver": { + "value": "Meso S1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionjbronze": { + "value": "Meso S2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionjgold": { + "value": "Meso S2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionjplatinum": { + "value": "Meso S2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionjsilver": { + "value": "Meso S2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionkbronze": { + "value": "Meso F1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionkgold": { + "value": "Meso F1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionkplatinum": { + "value": "Meso F1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionksilver": { + "value": "Meso F1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionmbronze": { + "value": "Meso C2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionmgold": { + "value": "Meso C2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionmplatinum": { + "value": "Meso C2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionmsilver": { + "value": "Meso C2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionnbronze": { + "value": "Meso V3 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionngold": { + "value": "Meso V3 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionnplatinum": { + "value": "Meso V3 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionnsilver": { + "value": "Meso V3 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionobronze": { + "value": "Meso S3 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionogold": { + "value": "Meso S3 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionoplatinum": { + "value": "Meso S3 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionosilver": { + "value": "Meso S3 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionqbronze": { + "value": "Meso F2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionqgold": { + "value": "Meso F2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionqplatinum": { + "value": "Meso F2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionqsilver": { + "value": "Meso F2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionrbronze": { + "value": "Meso N3 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionrgold": { + "value": "Meso N3 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionrplatinum": { + "value": "Meso N3 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionrsilver": { + "value": "Meso N3 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionsbronze": { + "value": "Meso S4 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionsgold": { + "value": "Meso S4 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionsplatinum": { + "value": "Meso S4 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectionssilver": { + "value": "Meso S4 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectiontbronze": { + "value": "Meso V4 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectiontgold": { + "value": "Meso V4 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectiontplatinum": { + "value": "Meso V4 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t2voidprojectiontsilver": { + "value": "Meso V4 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionabronze": { + "value": "Neo S1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionagold": { + "value": "Neo S1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionaplatinum": { + "value": "Neo S1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionasilver": { + "value": "Neo S1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionbbronze": { + "value": "Neo S2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionbgold": { + "value": "Neo S2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionbplatinum": { + "value": "Neo S2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionbsilver": { + "value": "Neo S2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectioncbronze": { + "value": "Neo N1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectioncgold": { + "value": "Neo N1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectioncplatinum": { + "value": "Neo N1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectioncsilver": { + "value": "Neo N1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectiondbronze": { + "value": "Neo N2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectiondgold": { + "value": "Neo N2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectiondplatinum": { + "value": "Neo N2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectiondsilver": { + "value": "Neo N2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionebronze": { + "value": "Neo V1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionegold": { + "value": "Neo V1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectioneplatinum": { + "value": "Neo V1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionesilver": { + "value": "Neo V1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionfbronze": { + "value": "Neo D1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionfgold": { + "value": "Neo D1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionfplatinum": { + "value": "Neo D1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionfsilver": { + "value": "Neo D1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectiongbronze": { + "value": "Neo S3 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionggold": { + "value": "Neo S3 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectiongplatinum": { + "value": "Neo S3 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectiongsilver": { + "value": "Neo S3 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionibronze": { + "value": "Neo N3 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionigold": { + "value": "Neo N3 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectioniplatinum": { + "value": "Neo N3 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionisilver": { + "value": "Neo N3 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionjbronze": { + "value": "Neo V2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionjgold": { + "value": "Neo V2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionjplatinum": { + "value": "Neo V2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionjsilver": { + "value": "Neo V2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionkbronze": { + "value": "Neo V3 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionkgold": { + "value": "Neo V3 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionkplatinum": { + "value": "Neo V3 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionksilver": { + "value": "Neo V3 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionmbronze": { + "value": "Neo A1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionmgold": { + "value": "Neo A1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionmplatinum": { + "value": "Neo A1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionmsilver": { + "value": "Neo A1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionnbronze": { + "value": "Neo V4 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionngold": { + "value": "Neo V4 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionnplatinum": { + "value": "Neo V4 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionnsilver": { + "value": "Neo V4 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionobronze": { + "value": "Neo N4 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionogold": { + "value": "Neo N4 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionoplatinum": { + "value": "Neo N4 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionosilver": { + "value": "Neo N4 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionqbronze": { + "value": "Neo S5 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionqgold": { + "value": "Neo S5 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionqplatinum": { + "value": "Neo S5 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionqsilver": { + "value": "Neo S5 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionrbronze": { + "value": "Neo T1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionrgold": { + "value": "Neo T1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionrplatinum": { + "value": "Neo T1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionrsilver": { + "value": "Neo T1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionsbronze": { + "value": "Neo N5 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionsgold": { + "value": "Neo N5 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionsplatinum": { + "value": "Neo N5 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionssilver": { + "value": "Neo N5 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectiontbronze": { + "value": "Neo B1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectiontgold": { + "value": "Neo B1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectiontplatinum": { + "value": "Neo B1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectiontsilver": { + "value": "Neo B1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionvoltodonataprimebronze": { + "value": "Neo O1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionvoltodonataprimegold": { + "value": "Neo O1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionvoltodonataprimeplatinum": { + "value": "Neo O1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t3voidprojectionvoltodonataprimesilver": { + "value": "Neo O1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionabronze": { + "value": "Axi S1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionagold": { + "value": "Axi S1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionaplatinum": { + "value": "Axi S1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionasilver": { + "value": "Axi S1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionbbronze": { + "value": "Axi V1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionbgold": { + "value": "Axi V1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionbplatinum": { + "value": "Axi V1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionbsilver": { + "value": "Axi V1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectioncbronze": { + "value": "Axi K1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectioncgold": { + "value": "Axi K1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectioncplatinum": { + "value": "Axi K1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectioncsilver": { + "value": "Axi K1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectiondbronze": { + "value": "Axi N1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectiondgold": { + "value": "Axi N1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectiondplatinum": { + "value": "Axi N1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectiondsilver": { + "value": "Axi N1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionebronze": { + "value": "Axi A1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionegold": { + "value": "Axi A1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectioneplatinum": { + "value": "Axi A1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionesilver": { + "value": "Axi A1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionfbronze": { + "value": "Axi V2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionfgold": { + "value": "Axi V2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionfplatinum": { + "value": "Axi V2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionfsilver": { + "value": "Axi V2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectiongbronze": { + "value": "Axi N2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionggold": { + "value": "Axi N2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectiongplatinum": { + "value": "Axi N2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectiongsilver": { + "value": "Axi N2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionhbronze": { + "value": "Axi V3 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionhgold": { + "value": "Axi V3 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionhplatinum": { + "value": "Axi V3 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionhsilver": { + "value": "Axi V3 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionibronze": { + "value": "Axi N3 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionigold": { + "value": "Axi N3 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectioniplatinum": { + "value": "Axi N3 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionisilver": { + "value": "Axi N3 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionjbronze": { + "value": "Axi T1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionjgold": { + "value": "Axi T1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionjplatinum": { + "value": "Axi T1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionjsilver": { + "value": "Axi T1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionkbronze": { + "value": "Axi G1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionkgold": { + "value": "Axi G1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionkplatinum": { + "value": "Axi G1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionksilver": { + "value": "Axi G1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionmbronze": { + "value": "Axi V4 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionmgold": { + "value": "Axi V4 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionmplatinum": { + "value": "Axi V4 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionmsilver": { + "value": "Axi V4 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionnbronze": { + "value": "Axi V5 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionngold": { + "value": "Axi V5 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionnplatinum": { + "value": "Axi V5 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionnsilver": { + "value": "Axi V5 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionobronze": { + "value": "Axi C1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionogold": { + "value": "Axi C1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionoplatinum": { + "value": "Axi C1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionosilver": { + "value": "Axi C1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionpbronze": { + "value": "Axi A2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionpgold": { + "value": "Axi A2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionpplatinum": { + "value": "Axi A2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionpsilver": { + "value": "Axi A2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionqbronze": { + "value": "Axi E1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionqgold": { + "value": "Axi E1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionqplatinum": { + "value": "Axi E1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionqsilver": { + "value": "Axi E1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionrbronze": { + "value": "Axi B1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionrgold": { + "value": "Axi B1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionrplatinum": { + "value": "Axi B1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionrsilver": { + "value": "Axi B1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionsbronze": { + "value": "Axi E2 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionsgold": { + "value": "Axi E2 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionsplatinum": { + "value": "Axi E2 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionssilver": { + "value": "Axi E2 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectiontbronze": { + "value": "Axi H1 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectiontgold": { + "value": "Axi H1 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectiontplatinum": { + "value": "Axi H1 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectiontsilver": { + "value": "Axi H1 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionvoltodonataprimebronze": { + "value": "Axi V8 Relic (Intact)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionvoltodonataprimegold": { + "value": "Axi V8 Relic (Flawless)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionvoltodonataprimeplatinum": { + "value": "Axi V8 Relic (Radiant)" + }, + "/lotus/storeitems/types/game/projections/t4voidprojectionvoltodonataprimesilver": { + "value": "Axi V8 Relic (Exceptional)" + }, + "/lotus/storeitems/types/game/solarrails/basicsolarrail": { + "value": "Solar Rail - Tower Class" + }, + "/lotus/storeitems/types/game/spectrearmies/bronzespectrearmy": { + "value": "Vapor Specter Regiment" + }, + "/lotus/storeitems/types/game/spectrearmies/goldspectrearmy": { + "value": "Force Specter Regiment" + }, + "/lotus/storeitems/types/game/spectrearmies/platinumspectrearmy": { + "value": "Cosmic Specter Regiment" + }, + "/lotus/storeitems/types/game/spectrearmies/silverspectrearmy": { + "value": "Phase Specter Regiment" + }, + "/lotus/storeitems/types/game/voidkeyitem": { + "value": "Orokin Void Key" + }, + "/lotus/storeitems/types/items/emotes/agreeemote": { + "value": "Agree" + }, + "/lotus/storeitems/types/items/emotes/bowemote": { + "value": "Bow" + }, + "/lotus/storeitems/types/items/emotes/bragemote": { + "value": "Boast" + }, + "/lotus/storeitems/types/items/emotes/clapemote": { + "value": "Clap" + }, + "/lotus/storeitems/types/items/emotes/deepbowemote": { + "value": "Deep Bow" + }, + "/lotus/storeitems/types/items/emotes/disagreeemote": { + "value": "Disagree" + }, + "/lotus/storeitems/types/items/emotes/farewellemote": { + "value": "Wave" + }, + "/lotus/storeitems/types/items/emotes/followemote": { + "value": "Follow" + }, + "/lotus/storeitems/types/items/emotes/kata2emote": { + "value": "Aquarid Narta" + }, + "/lotus/storeitems/types/items/emotes/kata3emote": { + "value": "Eclipse Narta" + }, + "/lotus/storeitems/types/items/emotes/kata5emote": { + "value": "Fathom Narta" + }, + "/lotus/storeitems/types/items/emotes/kataemote": { + "value": "Solstice Narta" + }, + "/lotus/storeitems/types/items/emotes/meditateemote": { + "value": "Meditate" + }, + "/lotus/storeitems/types/items/emotes/shrugemote": { + "value": "Shrug" + }, + "/lotus/storeitems/types/items/miscitems/alloyplate": { + "value": "Alloy Plate" + }, + "/lotus/storeitems/types/items/miscitems/alphacorruptorresource": { + "value": "Alpha Corruptor" + }, + "/lotus/storeitems/types/items/miscitems/archwingnavcode": { + "value": "Orokin Archive" + }, + "/lotus/storeitems/types/items/miscitems/argoncrystal": { + "value": "Argon Crystal" + }, + "/lotus/storeitems/types/items/miscitems/beacon": { + "value": "Proof Fragment" + }, + "/lotus/storeitems/types/items/miscitems/betacorruptorresource": { + "value": "Beta Corruptor" + }, + "/lotus/storeitems/types/items/miscitems/bossnavcode": { + "value": "Lephantis Nav Coordinate" + }, + "/lotus/storeitems/types/items/miscitems/circuits": { + "value": "Circuits" + }, + "/lotus/storeitems/types/items/miscitems/controlmodule": { + "value": "Control Module" + }, + "/lotus/storeitems/types/items/miscitems/cryotic": { + "value": "Cryotic" + }, + "/lotus/storeitems/types/items/miscitems/dangerroomkey": { + "value": "Simulacrum Access Key" + }, + "/lotus/storeitems/types/items/miscitems/datafragment": { + "value": "Tethra Data Fragments" + }, + "/lotus/storeitems/types/items/miscitems/ferrite": { + "value": "Ferrite" + }, + "/lotus/storeitems/types/items/miscitems/forma": { + "value": "Forma" + }, + "/lotus/storeitems/types/items/miscitems/gallium": { + "value": "Gallium" + }, + "/lotus/storeitems/types/items/miscitems/heknavcode": { + "value": "Vay Hek Nav Coordinate" + }, + "/lotus/storeitems/types/items/miscitems/infestedaladcoordinate": { + "value": "Mutalist Alad V Nav Coordinate" + }, + "/lotus/storeitems/types/items/miscitems/juggernautparta": { + "value": "Pulsating Tubercles" + }, + "/lotus/storeitems/types/items/miscitems/juggernautpartb": { + "value": "Infected Palpators" + }, + "/lotus/storeitems/types/items/miscitems/juggernautpartc": { + "value": "Chitinous Husk" + }, + "/lotus/storeitems/types/items/miscitems/juggernautpartd": { + "value": "Severed Bile Sac" + }, + "/lotus/storeitems/types/items/miscitems/libraryscannerdoublescanupgrade": { + "value": "Cross-matrix Widget" + }, + "/lotus/storeitems/types/items/miscitems/libraryscannerrechargeupgrade": { + "value": "Sol-battery Widget" + }, + "/lotus/storeitems/types/items/miscitems/libraryscannerscanspeedupgrade": { + "value": "Vector-thread Widget" + }, + "/lotus/storeitems/types/items/miscitems/miragecode": { + "value": "Orokin Cipher" + }, + "/lotus/storeitems/types/items/miscitems/morphic": { + "value": "Morphics" + }, + "/lotus/storeitems/types/items/miscitems/nanospores": { + "value": "Nano Spores" + }, + "/lotus/storeitems/types/items/miscitems/navcode": { + "value": "Nav Coordinate" + }, + "/lotus/storeitems/types/items/miscitems/neuralsensor": { + "value": "Neural Sensors" + }, + "/lotus/storeitems/types/items/miscitems/neurode": { + "value": "Neurodes" + }, + "/lotus/storeitems/types/items/miscitems/omegaisotope": { + "value": "Omega Isotope" + }, + "/lotus/storeitems/types/items/miscitems/orokincatalyst": { + "value": "Orokin Catalyst" + }, + "/lotus/storeitems/types/items/miscitems/orokincell": { + "value": "Orokin Cell" + }, + "/lotus/storeitems/types/items/miscitems/orokinreactor": { + "value": "Orokin Reactor" + }, + "/lotus/storeitems/types/items/miscitems/oxiumalloy": { + "value": "Oxium" + }, + "/lotus/storeitems/types/items/miscitems/photoboothtileinarostomb": { + "value": "Inaros Tomb Scene" + }, + "/lotus/storeitems/types/items/miscitems/plastids": { + "value": "Plastids" + }, + "/lotus/storeitems/types/items/miscitems/polymerbundle": { + "value": "Polymer Bundle" + }, + "/lotus/storeitems/types/items/miscitems/polymerbundle240tutorialquest": { + "value": "Polymer Bundle" + }, + "/lotus/storeitems/types/items/miscitems/polymerbundleraidtutorial": { + "value": "Polymer Bundle" + }, + "/lotus/storeitems/types/items/miscitems/primebucks": { + "value": "Orokin Ducats" + }, + "/lotus/storeitems/types/items/miscitems/rubedo": { + "value": "Rubedo" + }, + "/lotus/storeitems/types/items/miscitems/salvage": { + "value": "Salvage" + }, + "/lotus/storeitems/types/items/miscitems/salvage450tutorialquest": { + "value": "Salvage" + }, + "/lotus/storeitems/types/items/miscitems/salvageraidtutorial": { + "value": "Salvage" + }, + "/lotus/storeitems/types/items/miscitems/stablecorruptorresource": { + "value": "Stable Corruptor" + }, + "/lotus/storeitems/types/items/miscitems/tellurium": { + "value": "Tellurium" + }, + "/lotus/storeitems/types/items/miscitems/utilityunlocker": { + "value": "Exilus Adapter" + }, + "/lotus/storeitems/types/items/miscitems/vayhekcoordinatefragmenta": { + "value": "Delta Beacon" + }, + "/lotus/storeitems/types/items/miscitems/vayhekcoordinatefragmentb": { + "value": "Gamma Beacon" + }, + "/lotus/storeitems/types/items/miscitems/vayhekcoordinatefragmentc": { + "value": "Kappa Beacon" + }, + "/lotus/storeitems/types/items/miscitems/vayhekcoordinatefragmentd": { + "value": "Omega Beacon" + }, + "/lotus/storeitems/types/items/plants/miscitems/commondayplantitem": { + "value": "Sunlight Threshcone Extract" + }, + "/lotus/storeitems/types/items/plants/miscitems/commonnightplantitem": { + "value": "Moonlight Threshcone Extract" + }, + "/lotus/storeitems/types/items/plants/miscitems/raredayplantitem": { + "value": "Sunlight Jadeleaf Extract" + }, + "/lotus/storeitems/types/items/plants/miscitems/rarenightplantitem": { + "value": "Moonlight Jadeleaf Extract" + }, + "/lotus/storeitems/types/items/plants/miscitems/uncommondayplantitem": { + "value": "Sunlight Dragonlily Extract" + }, + "/lotus/storeitems/types/items/plants/miscitems/uncommonnightplantitem": { + "value": "Moonlight Dragonlily Extract" + }, + "/lotus/storeitems/types/items/research/biocomponent": { + "value": "Mutagen Mass" + }, + "/lotus/storeitems/types/items/research/biofragment": { + "value": "Mutagen Sample" + }, + "/lotus/storeitems/types/items/research/chemcomponent": { + "value": "Detonite Injector" + }, + "/lotus/storeitems/types/items/research/chemfragment": { + "value": "Detonite Ampule" + }, + "/lotus/storeitems/types/items/research/cipherplus": { + "value": "Corpus Cipher" + }, + "/lotus/storeitems/types/items/research/datamassplus": { + "value": "Corpus Datamass" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocoloreartha": { + "value": "River Blue" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolorearthb": { + "value": "Tree Green" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolorearthc": { + "value": "Sand Yellow" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolorearthd": { + "value": "Oak Brown" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolorearthe": { + "value": "Night Blue" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolorfalldojoa": { + "value": "Leech Green" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolorfalldojob": { + "value": "Moa Green" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolorfalldojoc": { + "value": "Autumn Brown" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolorfalldojod": { + "value": "Leaf Red" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolorfalldojoe": { + "value": "Dust Brown" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocoloriceplaneta": { + "value": "Glacial Blue" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocoloriceplanetb": { + "value": "Jackal Yellow" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocoloriceplanetc": { + "value": "Morning Yellow" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocoloriceplanetd": { + "value": "Anti Violet" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocoloriceplanete": { + "value": "Railgun Blue" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolorinfesteda": { + "value": "Boiler Red" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolorinfestedb": { + "value": "Mutalist Red" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolorinfestedc": { + "value": "Crawler Blue" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolorinfestedd": { + "value": "Charger Blue" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolorinfestede": { + "value": "Nanite Blue" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolormarsattacksa": { + "value": "Elysium Blue" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolormarsattacksb": { + "value": "Olympus Blue" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolormarsattacksc": { + "value": "Syrtis Orange" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolormarsattacksd": { + "value": "Hesperia Brown" + }, + "/lotus/storeitems/types/items/research/dojocolors/dojocolormarsattackse": { + "value": "Tharsis Brown" + }, + "/lotus/storeitems/types/items/research/energycomponent": { + "value": "Fieldron" + }, + "/lotus/storeitems/types/items/research/energyfragment": { + "value": "Fieldron Sample" + }, + "/lotus/storeitems/types/items/shipchristmasifier": { + "value": "Festive Interior Decorations" + }, + "/lotus/storeitems/types/items/shipdecos/aladvbobblehead": { + "value": "Noggle Statue - Alad V" + }, + "/lotus/storeitems/types/items/shipdecos/ashbobblehead": { + "value": "Noggle Statue - Ash" + }, + "/lotus/storeitems/types/items/shipdecos/bansheebobblehead": { + "value": "Noggle Statue - Banshee" + }, + "/lotus/storeitems/types/items/shipdecos/barokiteerbobblehead": { + "value": "Noggle Statue - Baro Ki'Teer" + }, + "/lotus/storeitems/types/items/shipdecos/conclaveoroornament": { + "value": "Oro Ornament" + }, + "/lotus/storeitems/types/items/shipdecos/emberbobblehead": { + "value": "Noggle Statue - Ember" + }, + "/lotus/storeitems/types/items/shipdecos/excaliburbobblehead": { + "value": "Noggle Statue - Excalibur" + }, + "/lotus/storeitems/types/items/shipdecos/excaliburjadebobblehead": { + "value": "Noggle Statue - Jade Excalibur" + }, + "/lotus/storeitems/types/items/shipdecos/excaliburobsidianbobblehead": { + "value": "Noggle Statue - Obsidian Excalibur" + }, + "/lotus/storeitems/types/items/shipdecos/excaliburprimebobblehead": { + "value": "Noggle Statue - Excalibur Prime" + }, + "/lotus/storeitems/types/items/shipdecos/excaliburprismabobblehead": { + "value": "Noggle Statue - Prisma Excalibur" + }, + "/lotus/storeitems/types/items/shipdecos/excaliburprotobobblehead": { + "value": "Noggle Statue - Proto-excalibur" + }, + "/lotus/storeitems/types/items/shipdecos/frostbobblehead": { + "value": "Noggle Statue - Frost" + }, + "/lotus/storeitems/types/items/shipdecos/grineerexcavationbossbobblehead": { + "value": "Noggle Statue - Boril" + }, + "/lotus/storeitems/types/items/shipdecos/grineermarinealt2desertbobblehead": { + "value": "Noggle Statue - Elite Arid Lancer" + }, + "/lotus/storeitems/types/items/shipdecos/grineermarinealtarcticbobblehead": { + "value": "Noggle Statue - Elite Lancer" + }, + "/lotus/storeitems/types/items/shipdecos/grineermarinealtdesertbobblehead": { + "value": "Noggle Statue - Arid Seeker" + }, + "/lotus/storeitems/types/items/shipdecos/grineermarinearcticbobblehead": { + "value": "Noggle Statue - Arid Lancer" + }, + "/lotus/storeitems/types/items/shipdecos/grineermarinebobblehead": { + "value": "Noggle Statue - Lancer" + }, + "/lotus/storeitems/types/items/shipdecos/grineermarinedesertbobblehead": { + "value": "Noggle Statue - Arid Lancer" + }, + "/lotus/storeitems/types/items/shipdecos/huladancingdoll": { + "value": "Statuette - Dancing Doll" + }, + "/lotus/storeitems/types/items/shipdecos/hydroidbobblehead": { + "value": "Noggle Statue - Hydroid" + }, + "/lotus/storeitems/types/items/shipdecos/lokibobblehead": { + "value": "Noggle Statue - Loki" + }, + "/lotus/storeitems/types/items/shipdecos/magbobblehead": { + "value": "Noggle Statue - Mag" + }, + "/lotus/storeitems/types/items/shipdecos/miragebobblehead": { + "value": "Noggle Statue - Mirage" + }, + "/lotus/storeitems/types/items/shipdecos/nekrosbobblehead": { + "value": "Noggle Statue - Nekros" + }, + "/lotus/storeitems/types/items/shipdecos/novabobblehead": { + "value": "Noggle Statue - Nova" + }, + "/lotus/storeitems/types/items/shipdecos/nyxbobblehead": { + "value": "Noggle Statue - Nyx" + }, + "/lotus/storeitems/types/items/shipdecos/oberonbobblehead": { + "value": "Noggle Statue - Oberon" + }, + "/lotus/storeitems/types/items/shipdecos/orbiterpictureframebaro": { + "value": "Display - Argyle" + }, + "/lotus/storeitems/types/items/shipdecos/pedistalprime": { + "value": "Pedestal Prime" + }, + "/lotus/storeitems/types/items/shipdecos/rhinobobblehead": { + "value": "Noggle Statue - Rhino" + }, + "/lotus/storeitems/types/items/shipdecos/sargusrukbobblehead": { + "value": "Noggle Statue - Sargas Ruk" + }, + "/lotus/storeitems/types/items/shipdecos/sarynbobblehead": { + "value": "Noggle Statue - Saryn" + }, + "/lotus/storeitems/types/items/shipdecos/trinitybobblehead": { + "value": "Noggle Statue - Trinity" + }, + "/lotus/storeitems/types/items/shipdecos/valkyrbobblehead": { + "value": "Noggle Statue - Valkyr" + }, + "/lotus/storeitems/types/items/shipdecos/vaubanbobblehead": { + "value": "Noggle Statue - Vauban" + }, + "/lotus/storeitems/types/items/shipdecos/voltbobblehead": { + "value": "Noggle Statue - Volt" + }, + "/lotus/storeitems/types/items/shipdecos/vorbobblehead": { + "value": "Noggle Statue - Vor" + }, + "/lotus/storeitems/types/items/shipdecos/zephyrbobblehead": { + "value": "Noggle Statue - Zephyr" + }, + "/lotus/storeitems/types/items/shipfeatureitems/alertsfeatureitem": { + "value": "Alerts Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/arsenalfeatureitem": { + "value": "Arsenal Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/ceresnavigationfeatureitem": { + "value": "Ceres Nav Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/clanfeatureitem": { + "value": "Clan Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/earthnavigationfeatureitem": { + "value": "Earth Nav Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/erisnavigationfeatureitem": { + "value": "Eris Nav Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/europanavigationfeatureitem": { + "value": "Europa Nav Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/foundryfeatureitem": { + "value": "Foundry Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/geneticfoundryfeatureitem": { + "value": "Incubator Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/jupiternavigationfeatureitem": { + "value": "Jupiter Nav Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/markettieronefeatureitem": { + "value": "Market Tier 1 Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/markettiertwofeatureitem": { + "value": "Market Tier 2 Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/marsnavigationfeatureitem": { + "value": "Mars Nav Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/mercurynavigationfeatureitem": { + "value": "Galleon Nav Coordinates" + }, + "/lotus/storeitems/types/items/shipfeatureitems/modsfeatureitem": { + "value": "Mods Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/modsfusionfeatureitem": { + "value": "Mod Fusion Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/modstransmutefeatureitem": { + "value": "Mod Transmute Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/neptunenavigationfeatureitem": { + "value": "Neptune Nav Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/phobosnavigationfeatureitem": { + "value": "Phobos Nav Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/plutonavigationfeatureitem": { + "value": "Pluto Nav Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/saturnnavigationfeatureitem": { + "value": "Saturn Nav Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/sednanavigationfeatureitem": { + "value": "Sedna Nav Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/socialmenufeatureitem": { + "value": "Comms Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/solarchartfeatureitem": { + "value": "Solar Chart Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/uranusnavigationfeatureitem": { + "value": "Uranus Nav Segment" + }, + "/lotus/storeitems/types/items/shipfeatureitems/venusnavigationfeatureitem": { + "value": "Venus Nav Segment" + }, + "/lotus/storeitems/types/items/syndicatedogtags/arbitersdogtag": { + "value": "Medallion" + }, + "/lotus/storeitems/types/items/syndicatedogtags/arbitersraredogtag": { + "value": "Maxim Medallion" + }, + "/lotus/storeitems/types/items/syndicatedogtags/arbitersuncommondogtag": { + "value": "Lawful Medallion" + }, + "/lotus/storeitems/types/items/syndicatedogtags/cephalondogtag": { + "value": "Datum" + }, + "/lotus/storeitems/types/items/syndicatedogtags/cephalonraredogtag": { + "value": "Genius Datum" + }, + "/lotus/storeitems/types/items/syndicatedogtags/cephalonuncommondogtag": { + "value": "Intriguing Datum" + }, + "/lotus/storeitems/types/items/syndicatedogtags/kelaeventdogtag": { + "value": "Grineer Defector's Location" + }, + "/lotus/storeitems/types/items/syndicatedogtags/newlokadogtag": { + "value": "Seed" + }, + "/lotus/storeitems/types/items/syndicatedogtags/newlokararedogtag": { + "value": "Flawless Seed" + }, + "/lotus/storeitems/types/items/syndicatedogtags/newlokauncommondogtag": { + "value": "Bountiful Seed" + }, + "/lotus/storeitems/types/items/syndicatedogtags/perrindogtag": { + "value": "Quittance" + }, + "/lotus/storeitems/types/items/syndicatedogtags/perrinraredogtag": { + "value": "Partner Quittance" + }, + "/lotus/storeitems/types/items/syndicatedogtags/perrinuncommondogtag": { + "value": "Executive Quittance" + }, + "/lotus/storeitems/types/items/syndicatedogtags/redveildogtag": { + "value": "Mark" + }, + "/lotus/storeitems/types/items/syndicatedogtags/redveilraredogtag": { + "value": "Exalted Mark" + }, + "/lotus/storeitems/types/items/syndicatedogtags/redveiluncommondogtag": { + "value": "Honored Mark" + }, + "/lotus/storeitems/types/items/syndicatedogtags/steelmeridiandogtag": { + "value": "Insignia" + }, + "/lotus/storeitems/types/items/syndicatedogtags/steelmeridianraredogtag": { + "value": "General Insignia" + }, + "/lotus/storeitems/types/items/syndicatedogtags/steelmeridianuncommondogtag": { + "value": "Defender Insignia" + }, + "/lotus/storeitems/types/keys/archwingquest/archwingquestkeychain": { + "value": "The Archwing" + }, + "/lotus/storeitems/types/keys/archwingquest/missionfour": { + "value": "Find Corpus Intelligence About The Balor Fomorians" + }, + "/lotus/storeitems/types/keys/archwingquest/missionone": { + "value": "Recover The Orokin Archive" + }, + "/lotus/storeitems/types/keys/archwingquest/missionthree": { + "value": "Find Corpus Intelligence About The Balor Fomorians" + }, + "/lotus/storeitems/types/keys/archwingquest/missiontwo": { + "value": "Extract The Odonata Archwing Wings Blueprint" + }, + "/lotus/storeitems/types/keys/corpuscapturekey": { + "value": "Corpus Void Key" + }, + "/lotus/storeitems/types/keys/derelictcapturekey": { + "value": "Orokin Derelict Capture" + }, + "/lotus/storeitems/types/keys/derelictdefensekey": { + "value": "Orokin Derelict Defense" + }, + "/lotus/storeitems/types/keys/derelictexterminatekey": { + "value": "Orokin Derelict Exterminate" + }, + "/lotus/storeitems/types/keys/derelictgolemkey": { + "value": "Orokin Derelict Assassinate" + }, + "/lotus/storeitems/types/keys/derelictsabotagekey": { + "value": "Orokin Derelict Sabotage" + }, + "/lotus/storeitems/types/keys/derelictsurvivalkey": { + "value": "Orokin Derelict Survival" + }, + "/lotus/storeitems/types/keys/dojokey": { + "value": "Clan Key" + }, + "/lotus/storeitems/types/keys/dragonquest/dragonquestkeychain": { + "value": "The New Strange" + }, + "/lotus/storeitems/types/keys/dragonquest/dragonquestmissionfour": { + "value": "Defeat Chroma" + }, + "/lotus/storeitems/types/keys/dragonquest/dragonquestmissionone": { + "value": "Find Cephalon Simaris' Missing Sentinels" + }, + "/lotus/storeitems/types/keys/dragonquest/dragonquestmissionthree": { + "value": "Revisit The Derelict" + }, + "/lotus/storeitems/types/keys/dragonquest/dragonquestmissiontwo": { + "value": "Investigate The Source Of The Transmission" + }, + "/lotus/storeitems/types/keys/infestedaladvquest/assassinateinfestedaladvkey": { + "value": "Mutalist Alad V Assassinate" + }, + "/lotus/storeitems/types/keys/infestedaladvquest/infestedaladvquestkeychain": { + "value": "Patient Zero" + }, + "/lotus/storeitems/types/keys/infestedaladvquest/missionone": { + "value": "Find Out What The Corpus Know About Alad V" + }, + "/lotus/storeitems/types/keys/infestedaladvquest/missionthree": { + "value": "Destroy Alad V’s Laboratory Ship" + }, + "/lotus/storeitems/types/keys/infestedaladvquest/missiontwoa": { + "value": "Sabotage Alads Infested Ship At Brugia" + }, + "/lotus/storeitems/types/keys/infestedcorpushiveeventkey": { + "value": "Breeding Grounds" + }, + "/lotus/storeitems/types/keys/infestedintroquest/infestedintroquestkeychain": { + "value": "Once Awake" + }, + "/lotus/storeitems/types/keys/infestedintroquest/missionone": { + "value": "Investigate The Bio Weapon" + }, + "/lotus/storeitems/types/keys/infestedintroquest/missionthree": { + "value": "Defend The Bomb" + }, + "/lotus/storeitems/types/keys/infestedintroquest/missiontwo": { + "value": "Exterminate An Infestation" + }, + "/lotus/storeitems/types/keys/kubrowquest/kubrowquestkeychain": { + "value": "Howl Of The Kubrow" + }, + "/lotus/storeitems/types/keys/kubrowquest/missionone": { + "value": "Acquire The Incubator Segment" + }, + "/lotus/storeitems/types/keys/kubrowquest/missionthree": { + "value": "Defend Your Kubrow In Combat" + }, + "/lotus/storeitems/types/keys/kubrowquest/missiontwo": { + "value": "Find A Kubrow Egg In Feral Kubrow Dens" + }, + "/lotus/storeitems/types/keys/limboquest/limbobeaconkey": { + "value": "Limbo Theorem" + }, + "/lotus/storeitems/types/keys/limboquest/limbochassiskey": { + "value": "Limbo Chassis Theorem" + }, + "/lotus/storeitems/types/keys/limboquest/limbohelmetkey": { + "value": "Limbo Neuroptics Theorem" + }, + "/lotus/storeitems/types/keys/limboquest/limboquestkeychain": { + "value": "The Limbo Theorem" + }, + "/lotus/storeitems/types/keys/limboquest/limbosystemskey": { + "value": "Limbo Systems Theorem" + }, + "/lotus/storeitems/types/keys/miragequest/miragequestkeychain": { + "value": "Hidden Messages" + }, + "/lotus/storeitems/types/keys/miragequest/missionone": { + "value": "Solve The Riddle From The Inbox Message" + }, + "/lotus/storeitems/types/keys/miragequest/missionthree": { + "value": "Solve The Riddle From The Inbox Message" + }, + "/lotus/storeitems/types/keys/miragequest/missiontwo": { + "value": "Solve The Riddle From The Inbox Message" + }, + "/lotus/storeitems/types/keys/mummyquestkeyblueprint": { + "value": "Sands Of Inaros" + }, + "/lotus/storeitems/types/keys/nightmarekeyshipyardsretrieval": { + "value": "Tethra Shield Cipher" + }, + "/lotus/storeitems/types/keys/orokincapturekeya": { + "value": "Tower I Capture" + }, + "/lotus/storeitems/types/keys/orokincapturekeyb": { + "value": "Tower Ii Capture" + }, + "/lotus/storeitems/types/keys/orokincapturekeyc": { + "value": "Tower Iii Capture" + }, + "/lotus/storeitems/types/keys/orokindefensekeya": { + "value": "Tower I Defense" + }, + "/lotus/storeitems/types/keys/orokindefensekeyb": { + "value": "Tower Ii Defense" + }, + "/lotus/storeitems/types/keys/orokindefensekeyc": { + "value": "Tower Iii Defense" + }, + "/lotus/storeitems/types/keys/orokinkeya": { + "value": "Tower I Exterminate" + }, + "/lotus/storeitems/types/keys/orokinkeyb": { + "value": "Tower I Survival" + }, + "/lotus/storeitems/types/keys/orokinkeyc": { + "value": "Tower Ii Exterminate" + }, + "/lotus/storeitems/types/keys/orokinkeyd": { + "value": "Tower Ii Survival" + }, + "/lotus/storeitems/types/keys/orokinkeye": { + "value": "Tower Iii Exterminate" + }, + "/lotus/storeitems/types/keys/orokinmobiledefensekeya": { + "value": "Tower I Mobile Defense" + }, + "/lotus/storeitems/types/keys/orokinmobiledefensekeyb": { + "value": "Tower Ii Mobile Defense" + }, + "/lotus/storeitems/types/keys/orokinmobiledefensekeyc": { + "value": "Tower Iii Mobile Defense" + }, + "/lotus/storeitems/types/keys/orokintowerkeys/orokintowercapturetier4key": { + "value": "Tower Iv Capture" + }, + "/lotus/storeitems/types/keys/orokintowerkeys/orokintowerdefensetier4key": { + "value": "Tower Iv Defense" + }, + "/lotus/storeitems/types/keys/orokintowerkeys/orokintowerexterminatetier4key": { + "value": "Tower Iv Exterminate" + }, + "/lotus/storeitems/types/keys/orokintowerkeys/orokintowerinterceptiontier4key": { + "value": "Tower Iv Interception" + }, + "/lotus/storeitems/types/keys/orokintowerkeys/orokintowermobiledefensetier4key": { + "value": "Tower Iv Mobile Defense" + }, + "/lotus/storeitems/types/keys/orokintowerkeys/orokintowersabotagetier1key": { + "value": "Tower I Sabotage" + }, + "/lotus/storeitems/types/keys/orokintowerkeys/orokintowersabotagetier2key": { + "value": "Tower Ii Sabotage" + }, + "/lotus/storeitems/types/keys/orokintowerkeys/orokintowersabotagetier3key": { + "value": "Tower Iii Sabotage" + }, + "/lotus/storeitems/types/keys/orokintowerkeys/orokintowersabotagetier4key": { + "value": "Tower Iv Sabotage" + }, + "/lotus/storeitems/types/keys/orokintowerkeys/orokintowersurvivaltier4key": { + "value": "Tower Iv Survival" + }, + "/lotus/storeitems/types/keys/orokintowersurvivalt3key": { + "value": "Tower Iii Survival" + }, + "/lotus/storeitems/types/keys/raidkeys/raid01stage01keyitem": { + "value": "The Law Of Retribution" + }, + "/lotus/storeitems/types/keys/raidkeys/raid01stage01nightmarekeyitem": { + "value": "The Law Of Retribution (Nightmare)" + }, + "/lotus/storeitems/types/keys/raidkeys/raid01stage02keyitem": { + "value": "The Law Of Retribution" + }, + "/lotus/storeitems/types/keys/raidkeys/raid01stage02nightmarekeyitem": { + "value": "The Law Of Retribution (Nightmare)" + }, + "/lotus/storeitems/types/keys/raidkeys/raid01stage03keyitem": { + "value": "The Law Of Retribution" + }, + "/lotus/storeitems/types/keys/raidkeys/raid01stage03nightmarekeyitem": { + "value": "The Law Of Retribution (Nightmare)" + }, + "/lotus/storeitems/types/keys/settlementtestkey": { + "value": "Tower I Exterminate" + }, + "/lotus/storeitems/types/keys/spyquestkeychain/spyquestfinalkey": { + "value": "Find The Arcane Machine" + }, + "/lotus/storeitems/types/keys/spyquestkeychain/spyquestintrokey": { + "value": "Capture Maroo" + }, + "/lotus/storeitems/types/keys/spyquestkeychain/spyquestkeya": { + "value": "Take An Arcane Codex" + }, + "/lotus/storeitems/types/keys/spyquestkeychain/spyquestkeyb": { + "value": "Take The Grineer Arcane Codices" + }, + "/lotus/storeitems/types/keys/spyquestkeychain/spyquestkeyc": { + "value": "Take The Corpus Arcane Codices" + }, + "/lotus/storeitems/types/keys/spyquestkeychain/spyquestkeychain": { + "value": "Stolen Dreams" + }, + "/lotus/storeitems/types/keys/testkeyforestevent": { + "value": "Cicero Injector" + }, + "/lotus/storeitems/types/keys/testkeyinfestedcorpushive": { + "value": "Breeding Grounds" + }, + "/lotus/storeitems/types/keys/testkeyoutposthijack": { + "value": "Tethra Cipher" + }, + "/lotus/storeitems/types/keys/testkeyshipyardsinterception": { + "value": "Tethras Doom" + }, + "/lotus/storeitems/types/keys/testkeyshipyardsretrieval": { + "value": "Tethra Cipher" + }, + "/lotus/storeitems/types/keys/veyhekkey": { + "value": "Vay Hek Frequency Triangulator" + }, + "/lotus/storeitems/types/keys/vorsprize/missionfive": { + "value": "Obtain The Nav Segment" + }, + "/lotus/storeitems/types/keys/vorsprize/missionfour": { + "value": "Raid The Corpus Resource Caches" + }, + "/lotus/storeitems/types/keys/vorsprize/missionone": { + "value": "Restore Ship Comms" + }, + "/lotus/storeitems/types/keys/vorsprize/missionsix": { + "value": "Confront Captain Vor" + }, + "/lotus/storeitems/types/keys/vorsprize/missionthree": { + "value": "Locate The Foundry Segment" + }, + "/lotus/storeitems/types/keys/vorsprize/missiontwo": { + "value": "Liberate The Imprisoned Arms Dealer" + }, + "/lotus/storeitems/types/keys/vorsprize/vorsprizequestkeychain": { + "value": "Vors Prize" + }, + "/lotus/storeitems/types/pickups/credits/1000credits": { + "value": "1000 Credits Cache" + }, + "/lotus/storeitems/types/pickups/credits/1500credits": { + "value": "1500 Credits Cache" + }, + "/lotus/storeitems/types/pickups/credits/2000credits": { + "value": "2000 Credits Cache" + }, + "/lotus/storeitems/types/pickups/credits/2500credits": { + "value": "2500 Credits Cache" + }, + "/lotus/storeitems/types/pickups/credits/3000credits": { + "value": "3000 Credits Cache" + }, + "/lotus/storeitems/types/pickups/credits/4000credits": { + "value": "4000 Credits Cache" + }, + "/lotus/storeitems/types/pickups/credits/5000credits": { + "value": "5000 Credits Cache" + }, + "/lotus/storeitems/types/pickups/credits/500credits": { + "value": "500 Credits Cache" + }, + "/lotus/storeitems/types/recipes/archwingrecipes/demolitionarchwing/demolitionarchwingchassiscomponent": { + "value": "Elytron Harness" + }, + "/lotus/storeitems/types/recipes/archwingrecipes/demolitionarchwing/demolitionarchwingsystemscomponent": { + "value": "Elytron Systems" + }, + "/lotus/storeitems/types/recipes/archwingrecipes/demolitionarchwing/demolitionarchwingwingscomponent": { + "value": "Elytron Wings" + }, + "/lotus/storeitems/types/recipes/archwingrecipes/primearchwing/primearchwingchassiscomponent": { + "value": "Odonata Prime Harness" + }, + "/lotus/storeitems/types/recipes/archwingrecipes/primearchwing/primearchwingsystemscomponent": { + "value": "Odonata Prime Systems" + }, + "/lotus/storeitems/types/recipes/archwingrecipes/primearchwing/primearchwingwingscomponent": { + "value": "Odonata Prime Wings" + }, + "/lotus/storeitems/types/recipes/archwingrecipes/standardarchwing/standardarchwingchassiscomponent": { + "value": "Odonata Harness" + }, + "/lotus/storeitems/types/recipes/archwingrecipes/standardarchwing/standardarchwingsystemscomponent": { + "value": "Odonata Systems" + }, + "/lotus/storeitems/types/recipes/archwingrecipes/standardarchwing/standardarchwingwingscomponent": { + "value": "Odonata Wings" + }, + "/lotus/storeitems/types/recipes/archwingrecipes/stealtharchwing/stealtharchwingchassiscomponent": { + "value": "Itzal Harness" + }, + "/lotus/storeitems/types/recipes/archwingrecipes/stealtharchwing/stealtharchwingsystemscomponent": { + "value": "Itzal Systems" + }, + "/lotus/storeitems/types/recipes/archwingrecipes/stealtharchwing/stealtharchwingwingscomponent": { + "value": "Itzal Wings" + }, + "/lotus/storeitems/types/recipes/components/brandremovalfakeitem": { + "value": "Grustrag Bolt Release" + }, + "/lotus/storeitems/types/recipes/components/corruptedbombardballblueprint": { + "value": "Corrupted Bombard Specter Blueprint" + }, + "/lotus/storeitems/types/recipes/components/formablueprint": { + "value": "Forma Blueprint" + }, + "/lotus/storeitems/types/recipes/components/orokincatalystblueprint": { + "value": "Orokin Catalyst Blueprint" + }, + "/lotus/storeitems/types/recipes/components/orokinreactorblueprint": { + "value": "Orokin Reactor Blueprint" + }, + "/lotus/storeitems/types/recipes/components/vorboltremoverfakeitem": { + "value": "Ascaris Negator" + }, + "/lotus/storeitems/types/recipes/cosmeticenhancerblueprint": { + "value": "Arcane" + }, + "/lotus/storeitems/types/recipes/cosmeticenhancerfakeitem": { + "value": "Arcane" + }, + "/lotus/storeitems/types/recipes/darkswordblueprint": { + "value": "Dark Sword Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/animaalthelmetblueprint": { + "value": "Equinox Solstice Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/bardalthelmetblueprint": { + "value": "Octavia Cadenza Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/brawleralthelmetblueprint": { + "value": "Atlas Tartarus Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/brawleralttwohelmetblueprint": { + "value": "Atlas Shikoro Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/chromaaltbhelmetblueprint": { + "value": "Chroma Amaru Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/cowgirlalthelmetblueprint": { + "value": "Mesa Longhorn Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/dragonalthelmetblueprint": { + "value": "Chroma Drac Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/excaliburmordredhelmetblueprint": { + "value": "Excalibur Mordred Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/fairyalthelmetblueprint": { + "value": "Titania Aurai Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/glassalthelmetblueprint": { + "value": "Gara Virago Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/harlequinalthelmetblueprint": { + "value": "Mirage Harlequin Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/khoraalthelmetblueprint": { + "value": "Khora Delphi Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/limboaltbhelmetblueprint": { + "value": "Limbo Magrite Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/limboaristeashelmetblueprint": { + "value": "Limbo Aristeas Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/lokienigmahelmetblueprint": { + "value": "Loki Enigma Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/mesaaltbhelmetblueprint": { + "value": "Mesa Ovis Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/miragealtbhelmetblueprint": { + "value": "Mirage Trivelin Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/monkeykingaltbhelmetblueprint": { + "value": "Wukong Macak Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/nekrosaraknidhelmetblueprint": { + "value": "Nekros Raknis Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/nekrosshroudhelmetblueprint": { + "value": "Nekros Shroud Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/nezhaalthelmetblueprint": { + "value": "Nezha Circa Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/nezhaalt2helmetblueprint": { + "value": "Nezha Jinza Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/nidusalthelmetblueprint": { + "value": "Nidus Prion Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/novaquantumhelmetblueprint": { + "value": "Nova Quantum Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/novaslipstreamhelmetblueprint": { + "value": "Nova Slipstream Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/oberonaltbhelmetblueprint": { + "value": "Oberon Markhor Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/oberonalthelmetblueprint": { + "value": "Oberon Oryx Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/piratealtbhelmetblueprint": { + "value": "Hydroid Ketos Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/piratealthelmetblueprint": { + "value": "Hydroid Triton Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/priestalthelmetblueprint": { + "value": "Harrow Suffragan Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/rangeraltbhelmetblueprint": { + "value": "Ivara Zirastra Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/rangeralthelmetblueprint": { + "value": "Ivara Loxley Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/sandmanaltbhelmetblueprint": { + "value": "Inaros Canopic Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/sandmanalthelmetblueprint": { + "value": "Inaros Anubis Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessashalthelmetblueprint": { + "value": "Ash Scorpion Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessbansheealthelmetblueprint": { + "value": "Banshee Reverb Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessemberalthelmetblueprint": { + "value": "Ember Phoenix Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessexcaliburalthelmetblueprint": { + "value": "Excalibur Avalon Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessfrostalthelmetblueprint": { + "value": "Frost Aurora Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlesslokialthelmetblueprint": { + "value": "Loki Essence Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessmagalthelmetblueprint": { + "value": "Mag Coil Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessnovaalthelmetblueprint": { + "value": "Nova Flux Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessnyxalthelmetblueprint": { + "value": "Nyx Menticide Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessrhinoalthelmetblueprint": { + "value": "Rhino Thrak Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlesssarynalthelmetblueprint": { + "value": "Saryn Hemlock Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlesstrinityalthelmetblueprint": { + "value": "Trinity Aura Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessv2ashalthelmetblueprint": { + "value": "Ash Locust Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessv2bansheealthelmetblueprint": { + "value": "Banshee Chorus Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessv2emberalthelmetblueprint": { + "value": "Ember Backdraft Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessv2excaliburalthelmetblueprint": { + "value": "Excalibur Pendragon Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessv2frostalthelmetblueprint": { + "value": "Frost Squall Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessv2lokialthelmetblueprint": { + "value": "Loki Swindle Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessv2magalthelmetblueprint": { + "value": "Mag Gauss Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessv2nyxalthelmetblueprint": { + "value": "Nyx Vespa Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessv2rhinoalthelmetblueprint": { + "value": "Rhino Vanguard Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessv2sarynalthelmetblueprint": { + "value": "Saryn Chlora Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessv2trinityalthelmetblueprint": { + "value": "Trinity Meridian Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessv2vaubanalthelmetblueprint": { + "value": "Vauban Gambit Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessv2voltalthelmetblueprint": { + "value": "Volt Pulse Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessvaubanalthelmetblueprint": { + "value": "Vauban Esprit Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/statlessvoltalthelmetblueprint": { + "value": "Volt Storm Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/valkyraltbhelmetblueprint": { + "value": "Valkyr Kara Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/valkyrbastethelmetblueprint": { + "value": "Valkyr Bastet Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/vaubanhelmetsoldierblueprint": { + "value": "Vauban Armistice Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/wukongalthelmetblueprint": { + "value": "Wukong Dasheng Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/zephyrcierzohelmetblueprint": { + "value": "Zephyr Cierzo Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/helmets/zephyrtenguhelmetblueprint": { + "value": "Zephyr Tengu Helmet Blueprint" + }, + "/lotus/storeitems/types/recipes/warframerecipes/ashchassiscomponent": { + "value": "Ash Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/ashhelmetcomponent": { + "value": "Ash Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/ashprimechassiscomponent": { + "value": "Ash Prime Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/ashprimehelmetcomponent": { + "value": "Ash Prime Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/ashprimesystemscomponent": { + "value": "Ash Prime Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/ashsystemscomponent": { + "value": "Ash Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/bansheechassiscomponent": { + "value": "Banshee Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/bansheehelmetcomponent": { + "value": "Banshee Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/bansheesystemscomponent": { + "value": "Banshee Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/berserkerchassiscomponent": { + "value": "Valkyr Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/berserkerhelmetcomponent": { + "value": "Valkyr Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/berserkersystemscomponent": { + "value": "Valkyr Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/chromachassiscomponent": { + "value": "Chroma Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/chromahelmetcomponent": { + "value": "Chroma Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/chromasystemscomponent": { + "value": "Chroma Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/emberchassiscomponent": { + "value": "Ember Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/emberhelmetcomponent": { + "value": "Ember Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/emberprimechassiscomponent": { + "value": "Ember Prime Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/emberprimehelmetcomponent": { + "value": "Ember Prime Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/emberprimesystemscomponent": { + "value": "Ember Prime Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/embersystemscomponent": { + "value": "Ember Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/excaliburchassiscomponent": { + "value": "Excalibur Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/excaliburhelmetcomponent": { + "value": "Excalibur Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/excalibursystemscomponent": { + "value": "Excalibur Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/frostchassiscomponent": { + "value": "Frost Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/frosthelmetcomponent": { + "value": "Frost Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/frostprimechassiscomponent": { + "value": "Frost Prime Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/frostprimehelmetcomponent": { + "value": "Frost Prime Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/frostprimesystemscomponent": { + "value": "Frost Prime Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/frostsystemscomponent": { + "value": "Frost Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/gunslingerchassiscomponent": { + "value": "Mesa Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/gunslingerhelmetcomponent": { + "value": "Mesa Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/gunslingersystemscomponent": { + "value": "Mesa Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/harlequinchassiscomponent": { + "value": "Mirage Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/harlequinhelmetcomponent": { + "value": "Mirage Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/harlequinsystemscomponent": { + "value": "Mirage Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/hydroidchassiscomponent": { + "value": "Hydroid Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/hydroidhelmetcomponent": { + "value": "Hydroid Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/hydroidsystemscomponent": { + "value": "Hydroid Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/lokichassiscomponent": { + "value": "Loki Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/lokihelmetcomponent": { + "value": "Loki Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/lokiprimechassiscomponent": { + "value": "Loki Prime Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/lokiprimehelmetcomponent": { + "value": "Loki Prime Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/lokiprimesystemscomponent": { + "value": "Loki Prime Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/lokisystemscomponent": { + "value": "Loki Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/magchassiscomponent": { + "value": "Mag Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/maghelmetcomponent": { + "value": "Mag Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/magicianchassiscomponent": { + "value": "Limbo Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/magicianhelmetcomponent": { + "value": "Limbo Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/magiciansystemscomponent": { + "value": "Limbo Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/magprimechassiscomponent": { + "value": "Mag Prime Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/magprimehelmetcomponent": { + "value": "Mag Prime Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/magprimesystemscomponent": { + "value": "Mag Prime Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/magsystemscomponent": { + "value": "Mag Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/necrochassiscomponent": { + "value": "Nekros Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/necrohelmetcomponent": { + "value": "Nekros Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/necrosystemscomponent": { + "value": "Nekros Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/novachassiscomponent": { + "value": "Nova Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/novahelmetcomponent": { + "value": "Nova Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/novaprimechassiscomponent": { + "value": "Nova Prime Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/novaprimehelmetcomponent": { + "value": "Nova Prime Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/novaprimesystemscomponent": { + "value": "Nova Prime Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/novasystemscomponent": { + "value": "Nova Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/nyxchassiscomponent": { + "value": "Nyx Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/nyxhelmetcomponent": { + "value": "Nyx Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/nyxprimechassiscomponent": { + "value": "Nyx Prime Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/nyxprimehelmetcomponent": { + "value": "Nyx Prime Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/nyxprimesystemscomponent": { + "value": "Nyx Prime Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/nyxsystemscomponent": { + "value": "Nyx Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/paladinchassiscomponent": { + "value": "Oberon Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/paladinhelmetcomponent": { + "value": "Oberon Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/paladinsystemscomponent": { + "value": "Oberon Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/rhinochassiscomponent": { + "value": "Rhino Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/rhinohelmetcomponent": { + "value": "Rhino Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/rhinoprimechassiscomponent": { + "value": "Rhino Prime Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/rhinoprimehelmetcomponent": { + "value": "Rhino Prime Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/rhinoprimesystemscomponent": { + "value": "Rhino Prime Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/rhinosystemscomponent": { + "value": "Rhino Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/sarynchassiscomponent": { + "value": "Saryn Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/sarynhelmetcomponent": { + "value": "Saryn Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/sarynsystemscomponent": { + "value": "Saryn Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/tenguchassiscomponent": { + "value": "Zephyr Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/tenguhelmetcomponent": { + "value": "Zephyr Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/tengusystemscomponent": { + "value": "Zephyr Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/trapperchassisblueprint": { + "value": "Vauban Chassis Blueprint" + }, + "/lotus/storeitems/types/recipes/warframerecipes/trapperchassiscomponent": { + "value": "Vauban Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/trapperhelmetblueprint": { + "value": "Vauban Neuroptics Blueprint" + }, + "/lotus/storeitems/types/recipes/warframerecipes/trapperhelmetcomponent": { + "value": "Vauban Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/trappersystemsblueprint": { + "value": "Vauban Systems Blueprint" + }, + "/lotus/storeitems/types/recipes/warframerecipes/trappersystemscomponent": { + "value": "Vauban Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/trinitychassiscomponent": { + "value": "Trinity Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/trinityhelmetcomponent": { + "value": "Trinity Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/trinitysystemscomponent": { + "value": "Trinity Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/voltchassiscomponent": { + "value": "Volt Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/volthelmetcomponent": { + "value": "Volt Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/voltprimechassiscomponent": { + "value": "Volt Prime Chassis" + }, + "/lotus/storeitems/types/recipes/warframerecipes/voltprimehelmetcomponent": { + "value": "Volt Prime Neuroptics" + }, + "/lotus/storeitems/types/recipes/warframerecipes/voltprimesystemscomponent": { + "value": "Volt Prime Systems" + }, + "/lotus/storeitems/types/recipes/warframerecipes/voltsystemscomponent": { + "value": "Volt Systems" + }, + "/lotus/storeitems/types/recipes/weapons/ceramicdaggerblueprint": { + "value": "Ceramic Dagger Blueprint" + }, + "/lotus/storeitems/types/recipes/weapons/darkdaggerblueprint": { + "value": "Dark Dagger Blueprint" + }, + "/lotus/storeitems/types/recipes/weapons/glaiveblueprint": { + "value": "Glaive Blueprint" + }, + "/lotus/storeitems/types/recipes/weapons/heatdaggerblueprint": { + "value": "Heat Dagger Blueprint" + }, + "/lotus/storeitems/types/recipes/weapons/heatswordblueprint": { + "value": "Heat Sword Blueprint" + }, + "/lotus/storeitems/types/recipes/weapons/jawblueprint": { + "value": "Jaw Sword Blueprint" + }, + "/lotus/storeitems/types/recipes/weapons/pangolinswordblueprint": { + "value": "Pangolin Sword Blueprint" + }, + "/lotus/storeitems/types/recipes/weapons/plasmaswordblueprint": { + "value": "Plasma Sword Blueprint" + }, + "/lotus/storeitems/types/recipes/weapons/skins/daggeraxeblueprint": { + "value": "Dagger Axe Scindo Skin" + }, + "/lotus/storeitems/types/recipes/weapons/skins/dualdaggeraxeblueprint": { + "value": "Dagger Zoren Skin Blueprint" + }, + "/lotus/storeitems/types/recipes/weapons/skins/grnaxeblueprint": { + "value": "Scindo Manticore Axe Skin Blueprint" + }, + "/lotus/storeitems/types/recipes/weapons/skins/grnhammerblueprint": { + "value": "Brokk Hammer Skin Blueprint" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/akbroncoprimelink": { + "value": "Akbronco Prime Link" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/ankyrosprimeblade": { + "value": "Ankyros Prime Blade" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/ankyrosprimegauntlet": { + "value": "Ankyros Prime Gauntlet" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archaxeblade": { + "value": "Onorix Blade" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archaxehandle": { + "value": "Onorix Handle" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archcannonbarrel": { + "value": "Corvas Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archcannonreceiver": { + "value": "Corvas Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archcannonstock": { + "value": "Corvas Stock" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archhammerhandle": { + "value": "Rathbone Handle" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archhammerhead": { + "value": "Rathbone Head" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archheavypistolsbarrel": { + "value": "Decurion Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archheavypistolsreceiver": { + "value": "Decurion Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archrailgunbarrel": { + "value": "Velocitus Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archrailgunreceiver": { + "value": "Velocitus Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archrailgunstock": { + "value": "Velocitus Stock" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archrocketcrossbowbarrel": { + "value": "Fluctus Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archrocketcrossbowreceiver": { + "value": "Fluctus Stock" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archrocketcrossbowstock": { + "value": "Fluctus Limbs" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archswordshieldaegis": { + "value": "Centaur Aegis" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/archswordshieldblade": { + "value": "Centaur Blade" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/boarprimebarrel": { + "value": "Boar Prime Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/boarprimereceiver": { + "value": "Boar Prime Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/boarprimestock": { + "value": "Boar Prime Stock" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/boltorprimebarrel": { + "value": "Boltor Prime Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/boltorprimereceiver": { + "value": "Boltor Prime Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/boltorprimestock": { + "value": "Boltor Prime Stock" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/brakkbarrel": { + "value": "Brakk Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/brakkreceiver": { + "value": "Brakk Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/bratonprimebarrel": { + "value": "Braton Prime Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/bratonprimereceiver": { + "value": "Braton Prime Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/bratonprimestock": { + "value": "Braton Prime Stock" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/broncoprimebarrel": { + "value": "Bronco Prime Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/broncoprimereceiver": { + "value": "Bronco Prime Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/burstonprimebarrel": { + "value": "Burston Prime Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/burstonprimereceiver": { + "value": "Burston Prime Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/burstonprimestock": { + "value": "Burston Prime Stock" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/detronbarrel": { + "value": "Detron Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/detronreceiver": { + "value": "Detron Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/glaiveprimeblade": { + "value": "Glaive Prime Blade" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/glaiveprimedisc": { + "value": "Glaive Prime Disc" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/latronprimebarrel": { + "value": "Latron Prime Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/latronprimereceiver": { + "value": "Latron Prime Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/latronprimestock": { + "value": "Latron Prime Stock" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/lexprimebarrel": { + "value": "Lex Prime Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/lexprimereceiver": { + "value": "Lex Prime Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/miterbarrel": { + "value": "Miter Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/miterblade": { + "value": "Miter Blade" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/miterchassis": { + "value": "Miter Chassis" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/miterhandle": { + "value": "Miter Handle" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primebohandle": { + "value": "Bo Prime Handle" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primeboornament": { + "value": "Bo Prime Ornament" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primebowgrip": { + "value": "Paris Prime Grip" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primebowlowerlimb": { + "value": "Paris Prime Lower Limb" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primebowstring": { + "value": "Paris Prime String" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primebowupperlimb": { + "value": "Paris Prime Upper Limb" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primecarriercarapace": { + "value": "Carrier Prime Carapace" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primecarriercerebrum": { + "value": "Carrier Prime Cerebrum" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primecarriersystems": { + "value": "Carrier Prime Systems" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primecronuslongswordblade": { + "value": "Dakra Prime Blade" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primecronuslongswordhandle": { + "value": "Dakra Prime Handle" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primefangblade": { + "value": "Fang Prime Blade" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primefanghandle": { + "value": "Fang Prime Handle" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primehikouholster": { + "value": "Hikou Prime Pouch" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primehikoustars": { + "value": "Hikou Prime Stars" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primepolearmblade": { + "value": "Orthos Prime Blade" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primepolearmhandle": { + "value": "Orthos Prime Handle" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primescindoblade": { + "value": "Scindo Prime Blade" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primescindohandle": { + "value": "Scindo Prime Handle" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primescytheblade": { + "value": "Reaper Blade" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primescythehandle": { + "value": "Reaper Handle" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primewyrmcarapace": { + "value": "Wyrm Prime Carapace" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primewyrmcerebrum": { + "value": "Wyrm Prime Cerebrum" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/primewyrmsystems": { + "value": "Wyrm Prime Systems" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/sicarusprimebarrel": { + "value": "Sicarus Prime Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/sicarusprimereceiver": { + "value": "Sicarus Prime Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/somaprimebarrel": { + "value": "Soma Prime Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/somaprimereceiver": { + "value": "Soma Prime Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/somaprimestock": { + "value": "Soma Prime Stock" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/vastoprimebarrel": { + "value": "Vasto Prime Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/vastoprimereceiver": { + "value": "Vasto Prime Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/vectisprimebarrel": { + "value": "Vectis Prime Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/vectisprimereceiver": { + "value": "Vectis Prime Receiver" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/vectisprimestock": { + "value": "Vectis Prime Stock" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/vorspistolbarrel": { + "value": "Seer Pistol Barrel" + }, + "/lotus/storeitems/types/recipes/weapons/weaponparts/vorspistolreceiver": { + "value": "Seer Pistol Receiver" + }, + "/lotus/storeitems/types/restoratives/cipher": { + "value": "Cipher" + }, + "/lotus/storeitems/types/restoratives/clanteamammototem": { + "value": "Medium Team Ammo Restore" + }, + "/lotus/storeitems/types/restoratives/clanteamenergytotem": { + "value": "Medium Team Energy Restore" + }, + "/lotus/storeitems/types/restoratives/clanteamhealtotem": { + "value": "Medium Team Health Restore" + }, + "/lotus/storeitems/types/restoratives/clanteamshieldtotem": { + "value": "Medium Team Shield Restore" + }, + "/lotus/storeitems/types/restoratives/consumable/alphacorruptor": { + "value": "Alpha Corruptor" + }, + "/lotus/storeitems/types/restoratives/consumable/ancienthealerball": { + "value": "Ancient Healer Specter" + }, + "/lotus/storeitems/types/restoratives/consumable/assassinbait": { + "value": "Stalker Beacon" + }, + "/lotus/storeitems/types/restoratives/consumable/assassinbaitb": { + "value": "Zanuka Hunter Beacon" + }, + "/lotus/storeitems/types/restoratives/consumable/assassinbaitc": { + "value": "Grustrag Three Beacon" + }, + "/lotus/storeitems/types/restoratives/consumable/barofireworkscrate": { + "value": "Ki'Teer Fireworks" + }, + "/lotus/storeitems/types/restoratives/consumable/betacorruptor": { + "value": "Beta Corruptor" + }, + "/lotus/storeitems/types/restoratives/consumable/bronzespectre": { + "value": "Vapor Specter" + }, + "/lotus/storeitems/types/restoratives/consumable/chargerball": { + "value": "Charger Specter" + }, + "/lotus/storeitems/types/restoratives/consumable/corruptedlancerball": { + "value": "Corrupted Lancer Specter" + }, + "/lotus/storeitems/types/restoratives/consumable/creditchiplarge": { + "value": "Passionate Void Offering" + }, + "/lotus/storeitems/types/restoratives/consumable/creditchipmedium": { + "value": "Faithful Void Offering" + }, + "/lotus/storeitems/types/restoratives/consumable/creditchipsmall": { + "value": "Humble Void Offering" + }, + "/lotus/storeitems/types/restoratives/consumable/fireworkscrate": { + "value": "Grand Finale" + }, + "/lotus/storeitems/types/restoratives/consumable/fireworkssingle": { + "value": "Starburst" + }, + "/lotus/storeitems/types/restoratives/consumable/fomoriannegator": { + "value": "Fomorian Disruptor" + }, + "/lotus/storeitems/types/restoratives/consumable/fomoriannegatorbeta": { + "value": "[Placeholder] Fomorian Negator Beta" + }, + "/lotus/storeitems/types/restoratives/consumable/goldspectre": { + "value": "Force Specter" + }, + "/lotus/storeitems/types/restoratives/consumable/huntertool": { + "value": "Kinetic Siphon Trap" + }, + "/lotus/storeitems/types/restoratives/consumable/infestedbaitball": { + "value": "Pherliac Pods" + }, + "/lotus/storeitems/types/restoratives/consumable/libraryscanner": { + "value": "Synthesis Scanner" + }, + "/lotus/storeitems/types/restoratives/consumable/machetewomanball": { + "value": "Scorpion Specter" + }, + "/lotus/storeitems/types/restoratives/consumable/moaball": { + "value": "Moa Specter" + }, + "/lotus/storeitems/types/restoratives/consumable/platinumspectre": { + "value": "Cosmic Specter" + }, + "/lotus/storeitems/types/restoratives/consumable/prismaarrowbundle": { + "value": "Prisma Arrows" + }, + "/lotus/storeitems/types/restoratives/consumable/rollerball": { + "value": "Roller Specter" + }, + "/lotus/storeitems/types/restoratives/consumable/scanner": { + "value": "Codex Scanner" + }, + "/lotus/storeitems/types/restoratives/consumable/shielddroneball": { + "value": "Shield Osprey Specter" + }, + "/lotus/storeitems/types/restoratives/consumable/silverspectre": { + "value": "Phase Specter" + }, + "/lotus/storeitems/types/restoratives/consumable/stablecorruptor": { + "value": "Stable Corruptor" + }, + "/lotus/storeitems/types/restoratives/consumable/toxins/daycommonantitoxin": { + "value": "Beryl Antitoxin" + }, + "/lotus/storeitems/types/restoratives/consumable/toxins/dayuncommonantitoxin": { + "value": "Citrine Antitoxin" + }, + "/lotus/storeitems/types/restoratives/consumable/toxins/nightcommonantitoxin": { + "value": "Amethyst Antitoxin" + }, + "/lotus/storeitems/types/restoratives/consumable/toxins/nightuncommonantitoxin": { + "value": "Topaz Antitoxin" + }, + "/lotus/storeitems/types/restoratives/consumable/toxins/rareantitoxin": { + "value": "Lapis Antitoxin" + }, + "/lotus/storeitems/types/restoratives/consumable/toxins/solorareantitoxin": { + "value": "Vermillion Antitoxin" + }, + "/lotus/storeitems/types/restoratives/consumable/valentinesarrowbundle": { + "value": "Eros Arrow Skin" + }, + "/lotus/storeitems/types/restoratives/selfheallarge": { + "value": "Health Restore" + }, + "/lotus/storeitems/types/restoratives/selfhealsmall": { + "value": "Small Health Restore" + }, + "/lotus/storeitems/types/restoratives/selfomniammo": { + "value": "Omni Ammo Box" + }, + "/lotus/storeitems/types/restoratives/selfpistolammo": { + "value": "Pistol Ammo Box" + }, + "/lotus/storeitems/types/restoratives/selfrespawn": { + "value": "Revive Unit Refill" + }, + "/lotus/storeitems/types/restoratives/selfrevive": { + "value": "Revive" + }, + "/lotus/storeitems/types/restoratives/selfrifleammo": { + "value": "Rifle Ammo Box" + }, + "/lotus/storeitems/types/restoratives/selfshieldheal": { + "value": "Shield Restore" + }, + "/lotus/storeitems/types/restoratives/selfshotgunammo": { + "value": "Shotgun Ammo Box" + }, + "/lotus/storeitems/types/restoratives/selfsniperammo": { + "value": "Sniper Ammo Box" + }, + "/lotus/storeitems/types/restoratives/syndicateteamammototem": { + "value": "Large Team Ammo Restore" + }, + "/lotus/storeitems/types/restoratives/syndicateteamenergytotem": { + "value": "Large Team Energy Restore" + }, + "/lotus/storeitems/types/restoratives/syndicateteamhealtotem": { + "value": "Large Team Health Restore" + }, + "/lotus/storeitems/types/restoratives/syndicateteamshieldtotem": { + "value": "Large Team Shield Restore" + }, + "/lotus/storeitems/types/restoratives/teamammototem": { + "value": "Team Ammo Restore" + }, + "/lotus/storeitems/types/restoratives/teamenergytotem": { + "value": "Team Energy Restore" + }, + "/lotus/storeitems/types/restoratives/teamheal": { + "value": "Team Health Restore" + }, + "/lotus/storeitems/types/restoratives/teamhealtotem": { + "value": "Team Health Restore" + }, + "/lotus/storeitems/types/restoratives/teamshieldtotem": { + "value": "Team Shield Restore" + }, + "/lotus/storeitems/types/restoratives/upgraded/damagedebuffkey": { + "value": "Extinguished Dragon Key" + }, + "/lotus/storeitems/types/restoratives/upgraded/healthdebuffkey": { + "value": "Bleeding Dragon Key" + }, + "/lotus/storeitems/types/restoratives/upgraded/shielddebuffkey": { + "value": "Decaying Dragon Key" + }, + "/lotus/storeitems/types/restoratives/upgraded/speeddebuffkey": { + "value": "Hobbled Dragon Key" + }, + "/lotus/storeitems/types/sentinels/sentinelpowersuits/carrierpowersuit": { + "value": "Carrier" + }, + "/lotus/storeitems/types/sentinels/sentinelpowersuits/dethcubepowersuit": { + "value": "Dethcube" + }, + "/lotus/storeitems/types/sentinels/sentinelpowersuits/gubberpowersuit": { + "value": "Djinn" + }, + "/lotus/storeitems/types/sentinels/sentinelpowersuits/meleepetpowersuit": { + "value": "Helios" + }, + "/lotus/storeitems/types/sentinels/sentinelpowersuits/primecarrierpowersuit": { + "value": "Carrier Prime" + }, + "/lotus/storeitems/types/sentinels/sentinelpowersuits/primewyrmpowersuit": { + "value": "Wyrm Prime" + }, + "/lotus/storeitems/types/sentinels/sentinelpowersuits/prismashadepowersuit": { + "value": "Prisma Shade" + }, + "/lotus/storeitems/types/sentinels/sentinelpowersuits/shadepowersuit": { + "value": "Shade" + }, + "/lotus/storeitems/types/sentinels/sentinelpowersuits/wyrmpowersuit": { + "value": "Wyrm" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/bait": { + "value": "Fatal Attraction" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/boomstick": { + "value": "Striker" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/codexscannerprecept": { + "value": "Investigator" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/coolantleak": { + "value": "Coolant Leak" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/crowddispersion": { + "value": "Crowd Dispersion" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/ghost": { + "value": "Ghost" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/guardian": { + "value": "Guardian" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/itemvacum": { + "value": "Vacuum" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/looter": { + "value": "Looter" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/primedregen": { + "value": "Primed Regen" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/regen": { + "value": "Regen" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/revenge": { + "value": "Revenge" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/reviveplayer": { + "value": "Sacrifice" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/sanctuary": { + "value": "Sanctuary" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/swiftdeth": { + "value": "Swift Deth" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/throwglaiveprecept": { + "value": "Targeting Receptor" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/thumper": { + "value": "Thumper" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/vaporize": { + "value": "Vaporize" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/warrior": { + "value": "Warrior" + }, + "/lotus/storeitems/types/sentinels/sentinelprecepts/weaknessscanprecept": { + "value": "Detect Vulnerability" + }, + "/lotus/storeitems/types/sentinels/sentinelweapons/burstlaserpistol": { + "value": "Burst Laser" + }, + "/lotus/storeitems/types/sentinels/sentinelweapons/dethmachinerifle": { + "value": "Deth Machine Rifle" + }, + "/lotus/storeitems/types/sentinels/sentinelweapons/laserrifle": { + "value": "Laser Rifle" + }, + "/lotus/storeitems/types/sentinels/sentinelweapons/primelaserrifle": { + "value": "Prime Laser Rifle" + }, + "/lotus/storeitems/types/sentinels/sentinelweapons/primesentshotgun": { + "value": "Sweeper Prime" + }, + "/lotus/storeitems/types/sentinels/sentinelweapons/sentbioweapon": { + "value": "Stinger" + }, + "/lotus/storeitems/types/sentinels/sentinelweapons/sentglaiveweapon": { + "value": "Deconstructor" + }, + "/lotus/storeitems/types/sentinels/sentinelweapons/sentshotgun": { + "value": "Sweeper" + }, + "/lotus/storeitems/types/ship/advancedresourcedrone": { + "value": "Titan Extractor Prime" + }, + "/lotus/storeitems/types/ship/advanceducresourcedrone": { + "value": "Distilling Extractor Prime" + }, + "/lotus/storeitems/types/ship/basicresourcedrone": { + "value": "Titan Extractor" + }, + "/lotus/storeitems/types/ship/basicucresourcedrone": { + "value": "Distilling Extractor" + }, + "/lotus/storeitems/types/ship/voidtraderresourcedrone": { + "value": "Prisma Niroda Extractor" + }, + "/lotus/storeitems/types/storeitems/avatarimages/avatarimagebaroicon": { + "value": "Ki'Teer Tribute Glyph" + }, + "/lotus/storeitems/types/storeitems/avatarimages/avatarimageitem1": { + "value": "Excalibur Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/avatarimageitem2": { + "value": "Volt Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/avatarimageitem3": { + "value": "Trinity Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/avatarimageitem4": { + "value": "Rhino Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/avatarimageitem5": { + "value": "Mag Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/avatarimageitem6": { + "value": "Ash Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/avatarimageitem7": { + "value": "Ember Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/avatarimageitem8": { + "value": "Loki Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/avatarimageitemfrostprime": { + "value": "Loki Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageashbright": { + "value": "Ash Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageashdark": { + "value": "Ash Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageashlocustbright": { + "value": "Ash Locust Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageashlocustdark": { + "value": "Ash Locust Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageashprimebright": { + "value": "Ash Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageashprimedark": { + "value": "Ash Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageashscorpionbright": { + "value": "Ash Scorpion Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageashscorpiondark": { + "value": "Ash Scorpion Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagebansheebright": { + "value": "Banshee Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagebansheechorusbright": { + "value": "Banshee Chorus Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagebansheechorusdark": { + "value": "Banshee Chorus Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagebansheedark": { + "value": "Banshee Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagebansheereverbbright": { + "value": "Banshee Reverb Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagebansheereverbdark": { + "value": "Banshee Reverb Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagebarokiteer": { + "value": "Ki'Teer Glyph" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagechromaamarubright": { + "value": "Chroma Amaru Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagechromaamarudark": { + "value": "Chroma Amaru Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagechromabright": { + "value": "Chroma Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagechromadark": { + "value": "Chroma Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagechromadracbright": { + "value": "Chroma Drac Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagechromadracdark": { + "value": "Chroma Drac Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageemberbackdraftbright": { + "value": "Ember Backdraft Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageemberbackdraftdark": { + "value": "Ember Backdraft Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageemberbright": { + "value": "Ember Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageemberdark": { + "value": "Ember Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageemberpheonixbright": { + "value": "Phoenix Ember Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageemberpheonixdark": { + "value": "Phoenix Ember Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageemberprimebright": { + "value": "Ember Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageemberprimedark": { + "value": "Ember Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageexcaliburavalonbright": { + "value": "Excalibur Avalon Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageexcaliburavalondark": { + "value": "Excalibur Avalon Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageexcaliburbright": { + "value": "Excalibur Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageexcaliburdark": { + "value": "Excalibur Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageexcaliburmordredbright": { + "value": "Excalibur Mordred Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageexcaliburmordreddark": { + "value": "Excalibur Mordred Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageexcaliburpendragonbright": { + "value": "Excalibur Pendragon Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageexcaliburpendragondark": { + "value": "Excalibur Pendragon Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageexcaliburprimebright": { + "value": "Excalibur Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageexcaliburprimedark": { + "value": "Excalibur Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageexcaliburproto": { + "value": "Excalibur Proto-suit Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagefrostaurorabright": { + "value": "Frost Aurora Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagefrostauroradark": { + "value": "Frost Aurora Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagefrostbright": { + "value": "Frost Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagefrostdark": { + "value": "Frost Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagefrostprimebright": { + "value": "Frost Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagefrostprimedark": { + "value": "Frost Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagefrostsquallbright": { + "value": "Frost Squall Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagefrostsqualldark": { + "value": "Frost Squall Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagegraeaelimbobright": { + "value": "Limbo Magrite Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagegraeaelimbodark": { + "value": "Limbo Magrite Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagegrineerballista": { + "value": "Grineer Ballista Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagegrineercaptainvor": { + "value": "Captain Vor Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagegrineerkeladethaym": { + "value": "Kela De Thaym Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagegrineerlancer": { + "value": "Grineer Lancer Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagegrineerroller": { + "value": "Grineer Roller Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagegrineersargusruk": { + "value": "Sargas Ruk Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagegunslingeraltbright": { + "value": "Mesa Longhorn Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagegunslingeraltdark": { + "value": "Mesa Longhorn Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagegunslingerbright": { + "value": "Mesa Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagegunslingerdark": { + "value": "Mesa Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagelimboaristeasbright": { + "value": "Limbo Aristeas Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagelimboaristeasdark": { + "value": "Limbo Aristeas Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagelimbobright": { + "value": "Limbo Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagelimbodark": { + "value": "Limbo Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagelokibright": { + "value": "Loki Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagelokidark": { + "value": "Loki Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagelokienigmabright": { + "value": "Loki Enigma Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagelokienigmadark": { + "value": "Loki Enigma Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagelokiessencebright": { + "value": "Loki Essence Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagelokiessencedark": { + "value": "Loki Essence Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagelokiprimebright": { + "value": "Loki Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagelokiprimedark": { + "value": "Loki Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagelokiswindlebright": { + "value": "Loki Swindle Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagelokiswindledark": { + "value": "Loki Swindle Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagemagbright": { + "value": "Mag Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagemagcoilbright": { + "value": "Mag Coil Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagemagcoildark": { + "value": "Mag Coil Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagemagdark": { + "value": "Mag Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagemaggaussbright": { + "value": "Mag Gauss Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagemaggaussdark": { + "value": "Mag Gauss Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagemagprimebright": { + "value": "Mag Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagemagprimedark": { + "value": "Mag Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagemesacortesbright": { + "value": "Mesa Ovis Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagemesacortesdark": { + "value": "Mesa Ovis Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagemiragebright": { + "value": "Mirage Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagemiragedark": { + "value": "Mirage Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagemirageharlequinbright": { + "value": "Mirage Harlequin Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagemirageharlequindark": { + "value": "Mirage Harlequin Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenekrosaraknidbright": { + "value": "Nekros Raknis Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenekrosarakniddark": { + "value": "Nekros Raknis Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenekrosbright": { + "value": "Nekros Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenekrosdark": { + "value": "Nekros Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenekrosshroudbright": { + "value": "Nekros Shroud Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenekrosshrouddark": { + "value": "Nekros Shroud Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenovaaltbright": { + "value": "Nova Flux Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenovaaltdark": { + "value": "Nova Flux Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenovabright": { + "value": "Nova Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenovadark": { + "value": "Nova Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenovaprimebright": { + "value": "Nova Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenovaprimedark": { + "value": "Nova Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenovaquantumbright": { + "value": "Nova Quantum Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenovaquantumdark": { + "value": "Nova Quantum Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenovaslipstreambright": { + "value": "Nova Slipstream Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenovaslipstreamdark": { + "value": "Nova Slipstream Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenyxbright": { + "value": "Nyx Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenyxdark": { + "value": "Nyx Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenyxmenticidebright": { + "value": "Nyx Menticide Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenyxmenticidedark": { + "value": "Nyx Menticide Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenyxprimebright": { + "value": "Nyx Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenyxprimedark": { + "value": "Nyx Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenyxvespabright": { + "value": "Nyx Vespa Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagenyxvespadark": { + "value": "Nyx Vespa Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageoberonaltbright": { + "value": "Oberon Oryx Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageoberonaltdark": { + "value": "Oberon Oryx Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageoberonbright": { + "value": "Oberon Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageoberondark": { + "value": "Oberon Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageoberonmarkhorbright": { + "value": "Oberon Markhor Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imageoberonmarkhordark": { + "value": "Oberon Markhor Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagepiratebright": { + "value": "Hydroid Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagepiratedark": { + "value": "Hydroid Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagepirateketosbright": { + "value": "Hydroid Ketos Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagepirateketosdark": { + "value": "Hydroid Ketos Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagepiratetritonbright": { + "value": "Hydroid Triton Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagepiratetritondark": { + "value": "Hydroid Triton Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagerhinobright": { + "value": "Rhino Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagerhinodark": { + "value": "Rhino Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagerhinoprimebright": { + "value": "Rhino Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagerhinoprimedark": { + "value": "Rhino Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagerhinothrakbright": { + "value": "Rhino Thrak Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagerhinothrakdark": { + "value": "Rhino Thrak Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagerhinovanguardbright": { + "value": "Rhino Vanguard Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagerhinovanguarddark": { + "value": "Rhino Vanguard Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagesarynbright": { + "value": "Saryn Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagesarynchlorabright": { + "value": "Saryn Chlora Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagesarynchloradark": { + "value": "Saryn Chlora Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagesaryndark": { + "value": "Saryn Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagesarynhemlockbright": { + "value": "Saryn Hemlock Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagesarynhemlockdark": { + "value": "Saryn Hemlock Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagesyndicateah": { + "value": "Arbiters Of Hexis Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagesyndicatecs": { + "value": "Cephalon Suda Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagesyndicatenl": { + "value": "New Loka Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagesyndicateps": { + "value": "Perrin Sequence Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagesyndicaterv": { + "value": "Red Veil Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagesyndicatesm": { + "value": "Steel Meridian Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetrapperaltbright": { + "value": "Vauban Esprit Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetrapperaltdark": { + "value": "Vauban Esprit Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetrapperbright": { + "value": "Vauban Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetrapperdark": { + "value": "Vauban Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetrappergambitbright": { + "value": "Vauban Gambit Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetrappergambitdark": { + "value": "Vauban Gambit Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetrappersoldierbright": { + "value": "Vauban Armistice Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetrappersoldierdark": { + "value": "Vauban Armistice Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetravelinmiragebright": { + "value": "Mirage Trivelin Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetravelinmiragedark": { + "value": "Mirage Trivelin Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetrinityaurabright": { + "value": "Trinity Aura Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetrinityauradark": { + "value": "Trinity Aura Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetrinitybright": { + "value": "Trinity Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetrinitydark": { + "value": "Trinity Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetrinitymeridianbright": { + "value": "Trinity Meridian Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagetrinitymeridiandark": { + "value": "Trinity Meridian Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagevalkyrbastetbright": { + "value": "Valkyr Bastet Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagevalkyrbastetdark": { + "value": "Valkyr Bastet Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagevalkyrbright": { + "value": "Valkyr Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagevalkyrdark": { + "value": "Valkyr Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagevalkyrkarabright": { + "value": "Valkyr Kara Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagevalkyrkaradark": { + "value": "Valkyr Kara Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagevoltbright": { + "value": "Volt Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagevoltdark": { + "value": "Volt Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagevoltprimebright": { + "value": "Volt Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagevoltprimedark": { + "value": "Volt Prime Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagevoltpulsebright": { + "value": "Volt Pulse Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagevoltpulsedark": { + "value": "Volt Pulse Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagevoltstormbright": { + "value": "Volt Storm Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagevoltstormdark": { + "value": "Volt Storm Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagezephyrbright": { + "value": "Zephyr Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagezephyrcierzobright": { + "value": "Zephyr Cierzo Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagezephyrcierzodark": { + "value": "Zephyr Cierzo Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagezephyrdark": { + "value": "Zephyr Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagezephyrtengubright": { + "value": "Zephyr Tengu Profile Icon" + }, + "/lotus/storeitems/types/storeitems/avatarimages/imagezephyrtengudark": { + "value": "Zephyr Tengu Profile Icon" + }, + "/lotus/storeitems/types/storeitems/consumables/restoratives/creditchiplargeblueprint": { + "value": "Passionate Void Offering" + }, + "/lotus/storeitems/types/storeitems/consumables/restoratives/creditchipmediumblueprint": { + "value": "Faithful Void Offering" + }, + "/lotus/storeitems/types/storeitems/creditbundles/creditbundlea": { + "value": "Frugal Credit Bundle" + }, + "/lotus/storeitems/types/storeitems/creditbundles/creditbundleb": { + "value": "Prodigal Credit Bundle" + }, + "/lotus/storeitems/types/storeitems/creditbundles/creditbundlec": { + "value": "High Roller Credit Bundle" + }, + "/lotus/storeitems/types/storeitems/slotitems/kubrowslotitem": { + "value": "Stasis Slot" + }, + "/lotus/storeitems/types/storeitems/slotitems/suitslotitem": { + "value": "Warframe Slot" + }, + "/lotus/storeitems/types/storeitems/slotitems/weaponslotitem": { + "value": "Weapon Slot" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickerbastilleitem": { + "value": "Bastille" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickerdaybreakitema": { + "value": "Daybreak" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickerdefaultsitema": { + "value": "Tenno" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickereasteritema": { + "value": "Easter" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickereximus": { + "value": "Eximus" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickerfireitema": { + "value": "Fire" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickergammaitema": { + "value": "Gamma" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickergrineeritema": { + "value": "Grineer" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickerhalloweenitema": { + "value": "Halloween" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickericeitema": { + "value": "Ice" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickerinfesteditema": { + "value": "Infested" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickeritem": { + "value": "Classic" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickeritemb": { + "value": "Classic Saturated" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickeritemc": { + "value": "Storm" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickeritemd": { + "value": "Color Picker D" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickerkiteeritema": { + "value": "Baro Ki'Teer Colors" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickerlotus": { + "value": "Lotus" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickerorokin": { + "value": "Orokin" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickerps4itema": { + "value": "Psiv" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickerrwbitem": { + "value": "Red/white/blue" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickershamrockitem": { + "value": "Shamrock" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickertwilightitema": { + "value": "Twilight" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/colourpickervalitema": { + "value": "Valentine" + }, + "/lotus/storeitems/types/storeitems/suitcustomizations/ninjacolourpickeritem": { + "value": "Smoke Colors" + }, + "/lotus/storeitems/types/weapon/lotuscustomaimweapon": { + "value": "Any" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/armourondamage": { + "value": "Arcane Guardian" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/corrosiveprocresist": { + "value": "Arcane Protection" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/critchanceondamage": { + "value": "Arcane Avenger" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/electricityprocresist": { + "value": "Arcane Resistance" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/explosionprocresist": { + "value": "Arcane Support" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/fireprocresist": { + "value": "Arcane Ice" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/freezeprocresist": { + "value": "Arcane Warmth" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/gasprocresist": { + "value": "Arcane Liquid" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/healthregenondamage": { + "value": "Arcane Grace" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/impactprocresist": { + "value": "Arcane Shield" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/instantshieldondamage": { + "value": "Arcane Barrier" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/magneticprocresist": { + "value": "Arcane Nullifier" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/poisonprocresist": { + "value": "Arcane Detoxifier" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/punctureprocresist": { + "value": "Arcane Defense" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/radiationprocresist": { + "value": "Arcane Healing" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/reflectdamageonparry": { + "value": "Arcane Vengeance" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/slashprocresist": { + "value": "Arcane Deflection" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/speedondamage": { + "value": "Arcane Agility" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/speedonparry": { + "value": "Arcane Phantasm" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/defensive/viralprocresist": { + "value": "Arcane Purity" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/offensive/guaranteedcritonmeleechannelkill": { + "value": "Arcane Mercy" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/offensive/healthregenonheadshot": { + "value": "Arcane Victory" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/offensive/invisibilityonfinisher": { + "value": "Arcane Trickery" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/offensive/longgundamageonheadshot": { + "value": "Arcane Rage" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/offensive/longgunspeedoncrit": { + "value": "Arcane Acceleration" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/offensive/meleespeedonhit": { + "value": "Arcane Strike" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/utility/abilitydurationoncast": { + "value": "Arcane Focus" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/utility/abilityrangeoncast": { + "value": "Arcane Emergence" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/utility/abilitystrengthoncast": { + "value": "Arcane Guide" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/utility/damagereductionduringrevive": { + "value": "Arcane Temperance" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/utility/pistoldamageonreload": { + "value": "Arcane Awakening" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/utility/radialhealonhealthpickup": { + "value": "Arcane Pulse" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/utility/radialknockdownonenergypickup": { + "value": "Arcane Eruption" + }, + "/lotus/storeitems/upgrades/cosmeticenhancers/utility/slowerbleedoutonpredeath": { + "value": "Arcane Survival" + }, + "/lotus/storeitems/upgrades/focus/attacklens": { + "value": "Madurai Lens" + }, + "/lotus/storeitems/upgrades/focus/defenselens": { + "value": "Vazarin Lens" + }, + "/lotus/storeitems/upgrades/focus/guardian/armorincreasefocus": { + "value": "Thick Skin" + }, + "/lotus/storeitems/upgrades/focus/guardian/healreceivebufffocus": { + "value": "Swift Wounds" + }, + "/lotus/storeitems/upgrades/focus/guardian/instantmaxenergyfocus": { + "value": "Energy Drink" + }, + "/lotus/storeitems/upgrades/focus/guardian/instantmaxhealthfocus": { + "value": "Healthy Attitude" + }, + "/lotus/storeitems/upgrades/focus/guardian/instantmaxshieldfocus": { + "value": "Insta Shield" + }, + "/lotus/storeitems/upgrades/focus/guardian/instantmaxstaminafocus": { + "value": "Insta-mina" + }, + "/lotus/storeitems/upgrades/focus/powerlens": { + "value": "Zenurik Lens" + }, + "/lotus/storeitems/upgrades/focus/tactician/alliesonfirefocus": { + "value": "Abyssal" + }, + "/lotus/storeitems/upgrades/focus/tacticlens": { + "value": "Naramon Lens" + }, + "/lotus/storeitems/upgrades/focus/void/energyefficiencyfocus": { + "value": "Channeling" + }, + "/lotus/storeitems/upgrades/focus/ward/damagehealsteamfocus": { + "value": "Martyr" + }, + "/lotus/storeitems/upgrades/focus/ward/enemyarmorreductionfocus": { + "value": "Rust" + }, + "/lotus/storeitems/upgrades/focus/ward/enemyshieldreductionfocus": { + "value": "Faulty Battery" + }, + "/lotus/storeitems/upgrades/focus/ward/healthincreaselinkfocus": { + "value": "Linked Fate" + }, + "/lotus/storeitems/upgrades/focus/ward/instantreviverfocus": { + "value": "Lucky Medic" + }, + "/lotus/storeitems/upgrades/focus/ward/regenweakerteammatesfocus": { + "value": "Empathy" + }, + "/lotus/storeitems/upgrades/focus/ward/reviveteamsentinelsfocus": { + "value": "Sentinel Rebirth" + }, + "/lotus/storeitems/upgrades/focus/wardlens": { + "value": "Unairu Lens" + }, + "/lotus/storeitems/upgrades/focus/warrior/killerfocussource": { + "value": "Killer Generator" + }, + "/lotus/storeitems/upgrades/focus/warrior/meleebuffgreatswordsfocus": { + "value": "Great Sword Master" + }, + "/lotus/storeitems/upgrades/focus/warrior/meleebuffhammersandaxesfocus": { + "value": "Hammer And Axe Time" + }, + "/lotus/storeitems/upgrades/focus/warrior/meleebuffswordsfocus": { + "value": "Sword Master" + }, + "/lotus/storeitems/upgrades/focus/warrior/npcaimreductionfocus": { + "value": "Evasion" + }, + "/lotus/storeitems/upgrades/focus/warrior/playerthreatincreasefocus": { + "value": "Taunt" + }, + "/lotus/storeitems/upgrades/focus/warrior/weaponaimbonuspistolfocus": { + "value": "Pistol Master" + }, + "/lotus/storeitems/upgrades/focus/warrior/weaponaimbonusriflefocus": { + "value": "Rifle Master" + }, + "/lotus/storeitems/upgrades/focus/warrior/weaponaimbonusshotgunfocus": { + "value": "Shotgun Master" + }, + "/lotus/storeitems/upgrades/mods/archwing/expert/archwingsuitabilitystrengthmodexpert": { + "value": "Primed Morphic Transformer" + }, + "/lotus/storeitems/upgrades/mods/archwing/melee/archwingeventfirestatusmeleemod": { + "value": "Searing Steel" + }, + "/lotus/storeitems/upgrades/mods/archwing/melee/archwingmeleecritchancemod": { + "value": "Tempered Blade" + }, + "/lotus/storeitems/upgrades/mods/archwing/melee/archwingmeleecritdamagemod": { + "value": "Bleeding Edge" + }, + "/lotus/storeitems/upgrades/mods/archwing/melee/archwingmeleedamagemod": { + "value": "Cutting Edge" + }, + "/lotus/storeitems/upgrades/mods/archwing/melee/archwingmeleefireratemod": { + "value": "Furor" + }, + "/lotus/storeitems/upgrades/mods/archwing/melee/archwingmeleerangeincmod": { + "value": "Extend" + }, + "/lotus/storeitems/upgrades/mods/archwing/melee/archwingmeleestatuschancemod": { + "value": "Sudden Impact" + }, + "/lotus/storeitems/upgrades/mods/archwing/melee/archwingweaponelectricitydamagemod": { + "value": "Galvanized Blade" + }, + "/lotus/storeitems/upgrades/mods/archwing/melee/archwingweaponfiredamagemod": { + "value": "Blazing Steel" + }, + "/lotus/storeitems/upgrades/mods/archwing/melee/archwingweaponfreezedamagemod": { + "value": "Glacial Edge" + }, + "/lotus/storeitems/upgrades/mods/archwing/melee/archwingweapontoxindamagemod": { + "value": "Poisonous Sting" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingeventfirestatusriflemod": { + "value": "Magma Chamber" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingrifleammomaxmod": { + "value": "Ammo Chain" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingriflechargespeedmod": { + "value": "Shell Rush" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingrifleclipmaxmod": { + "value": "Magazine Extension" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingriflecritchancemod": { + "value": "Parallax Scope" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingriflecritdamagemod": { + "value": "Hollowed Bullets" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingrifledamageamountmod": { + "value": "Rubedo-lined Barrel" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingriflefireiterationsmod": { + "value": "Dual Rounds" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingriflefireratemod": { + "value": "Automatic Trigger" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingriflerangemod": { + "value": "Ballista Measure" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingriflereloadspeedmod": { + "value": "Quick Reload" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingriflestatuschancemod": { + "value": "Modified Munitions" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingweaponelectricitydamagemod": { + "value": "Electrified Barrel" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingweaponfiredamagemod": { + "value": "Combustion Rounds" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingweaponfreezedamagemod": { + "value": "Polar Magazine" + }, + "/lotus/storeitems/upgrades/mods/archwing/rifle/archwingweapontoxindamagemod": { + "value": "Venomous Clip" + }, + "/lotus/storeitems/upgrades/mods/archwing/suit/archwingsuitabilitydurationmod": { + "value": "Efficient Transferral" + }, + "/lotus/storeitems/upgrades/mods/archwing/suit/archwingsuitabilityefficiencymod": { + "value": "System Reroute" + }, + "/lotus/storeitems/upgrades/mods/archwing/suit/archwingsuitabilityrangemod": { + "value": "Energy Amplifier" + }, + "/lotus/storeitems/upgrades/mods/archwing/suit/archwingsuitabilitystrengthmod": { + "value": "Morphic Transformer" + }, + "/lotus/storeitems/upgrades/mods/archwing/suit/archwingsuitarmourmod": { + "value": "Argon Plating" + }, + "/lotus/storeitems/upgrades/mods/archwing/suit/archwingsuithealthmaxmod": { + "value": "Enhanced Durability" + }, + "/lotus/storeitems/upgrades/mods/archwing/suit/archwingsuitpowermaxmod": { + "value": "Auxiliary Power" + }, + "/lotus/storeitems/upgrades/mods/archwing/suit/archwingsuitshieldmaxmod": { + "value": "Energy Inversion" + }, + "/lotus/storeitems/upgrades/mods/archwing/suit/archwingsuitshieldrechargeratemod": { + "value": "Superior Defenses" + }, + "/lotus/storeitems/upgrades/mods/archwing/suit/archwingsuitsprintspeedmod": { + "value": "Hyperion Thrusters" + }, + "/lotus/storeitems/upgrades/mods/aura/enemyarmorreductionauramod": { + "value": "Corrosive Projection" + }, + "/lotus/storeitems/upgrades/mods/aura/enemyshielddroneauramod": { + "value": "Shield Disruption" + }, + "/lotus/storeitems/upgrades/mods/aura/enemyshieldreductionauramod": { + "value": "Shield Disruption" + }, + "/lotus/storeitems/upgrades/mods/aura/infestationspeedreductionauramod": { + "value": "Infested Impedance" + }, + "/lotus/storeitems/upgrades/mods/aura/playerelectricityimmunityauramod": { + "value": "Electrical Resistance" + }, + "/lotus/storeitems/upgrades/mods/aura/playerenemyradarauramod": { + "value": "Enemy Radar" + }, + "/lotus/storeitems/upgrades/mods/aura/playerenergyregenauramod": { + "value": "Energy Siphon" + }, + "/lotus/storeitems/upgrades/mods/aura/playerfireimmunityauramod": { + "value": "Heat Resistance" + }, + "/lotus/storeitems/upgrades/mods/aura/playerfreezeimmunityauramod": { + "value": "Frost Insulation" + }, + "/lotus/storeitems/upgrades/mods/aura/playerhealthauramod": { + "value": "Physique" + }, + "/lotus/storeitems/upgrades/mods/aura/playerhealthregenauramod": { + "value": "Rejuvenation" + }, + "/lotus/storeitems/upgrades/mods/aura/playerholsterspeedauramod": { + "value": "Speed Holster" + }, + "/lotus/storeitems/upgrades/mods/aura/playerinfiniteclipauramod": { + "value": "Team Armory" + }, + "/lotus/storeitems/upgrades/mods/aura/playerlaserimmunityauramod": { + "value": "Laser Deflection" + }, + "/lotus/storeitems/upgrades/mods/aura/playerlootradarauramod": { + "value": "Loot Detector" + }, + "/lotus/storeitems/upgrades/mods/aura/playermeleeauramod": { + "value": "Steel Charge" + }, + "/lotus/storeitems/upgrades/mods/aura/playermeleeelectricitydamageauramod": { + "value": "Lightning Blades" + }, + "/lotus/storeitems/upgrades/mods/aura/playerpistolammoauramod": { + "value": "Pistol Scavenger" + }, + "/lotus/storeitems/upgrades/mods/aura/playerpistoldamageauramod": { + "value": "Pistol Amp" + }, + "/lotus/storeitems/upgrades/mods/aura/playerpoisonimmunityauramod": { + "value": "Toxin Resistance" + }, + "/lotus/storeitems/upgrades/mods/aura/playerrifleammoauramod": { + "value": "Rifle Scavenger" + }, + "/lotus/storeitems/upgrades/mods/aura/playerrifledamageauramod": { + "value": "Rifle Amp" + }, + "/lotus/storeitems/upgrades/mods/aura/playershellammoauramod": { + "value": "Shotgun Scavenger" + }, + "/lotus/storeitems/upgrades/mods/aura/playershelldamageauramod": { + "value": "Shotgun Amp" + }, + "/lotus/storeitems/upgrades/mods/aura/playersniperammoauramod": { + "value": "Sniper Scavenger" + }, + "/lotus/storeitems/upgrades/mods/aura/playersniperdamageauramod": { + "value": "Dead Eye" + }, + "/lotus/storeitems/upgrades/mods/aura/playersprintauramod": { + "value": "Sprint Boost" + }, + "/lotus/storeitems/upgrades/mods/aura/playerxpauramod": { + "value": "Affinity Amp" + }, + "/lotus/storeitems/upgrades/mods/aura/robotpooraimauramod": { + "value": "EMP Aura" + }, + "/lotus/storeitems/upgrades/mods/directormods/bossdropreductionaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/corrosivedamageenemyaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/electricdamageenemyaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/energydraincapturetargetaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/energylimitaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/fastenemylevelaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/halfshieldslevelaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/highdamageenemylevelaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/hivedoubledamageenemyaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/hiveextradamageenemyaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/icedamageenemyaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/iceprocenemyaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/juggernautwarninglevelaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/kubrowintensifieraura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/npcdropreductionaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/perftestextrahealthenemylevelaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/poisondamageenemyaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/portaleventaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/projectmutalistbonuslevelaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/projectmutalistlevelaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/pvpmeleechannelinglevelaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/raidenemydamageresistlevelaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/shipyardsinterceptionlevelaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/slashprocreductionaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/directormods/weakenemylevelaura": { + "value": "Unfused Artifact" + }, + "/lotus/storeitems/upgrades/mods/fusers/commonlvl1modfuser": { + "value": "C1 Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/commonlvl2modfuser": { + "value": "C2 Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/commonlvl3modfuser": { + "value": "C1 Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/commonmodfuser": { + "value": "Common Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacycommonlvl10modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacycommonlvl1modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacycommonlvl2modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacycommonlvl3modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacycommonlvl4modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacycommonlvl5modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacycommonlvl6modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacycommonlvl7modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacycommonlvl8modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacycommonlvl9modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacycommonmodfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyrarelvl10modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyrarelvl1modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyrarelvl2modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyrarelvl3modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyrarelvl4modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyrarelvl5modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyrarelvl6modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyrarelvl7modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyrarelvl8modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyrarelvl9modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyraremodfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyuncommonlvl10modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyuncommonlvl1modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyuncommonlvl2modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyuncommonlvl3modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyuncommonlvl4modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyuncommonlvl5modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyuncommonlvl6modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyuncommonlvl7modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyuncommonlvl8modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyuncommonlvl9modfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legacyuncommonmodfuser": { + "value": "Ancient Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/legendarymodfuser": { + "value": "Legendary Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/rarelvl1modfuser": { + "value": "R1 Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/rarelvl2modfuser": { + "value": "R2 Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/rarelvl3modfuser": { + "value": "R3 Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/rarelvl4modfuser": { + "value": "R4 Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/rarelvl5modfuser": { + "value": "R5 Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/raremodfuser": { + "value": "Rare Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/uncommonlvl1modfuser": { + "value": "U1 Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/uncommonlvl2modfuser": { + "value": "U2 Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/uncommonlvl3modfuser": { + "value": "U3 Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/uncommonlvl4modfuser": { + "value": "U4 Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/uncommonlvl5modfuser": { + "value": "U5 Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusers/uncommonmodfuser": { + "value": "Uncommon Fusion Core" + }, + "/lotus/storeitems/upgrades/mods/fusionbundles/alertfusionbundlelarge": { + "value": "150 Endo" + }, + "/lotus/storeitems/upgrades/mods/fusionbundles/alertfusionbundlemedium": { + "value": "100 Endo" + }, + "/lotus/storeitems/upgrades/mods/fusionbundles/alertfusionbundlesmall": { + "value": "80 Endo" + }, + "/lotus/storeitems/upgrades/mods/fusionbundles/rarefusionbundle": { + "value": "80 Endo" + }, + "/lotus/storeitems/upgrades/mods/fusionbundles/rarelvl1fusionbundle": { + "value": "30 Endo" + }, + "/lotus/storeitems/upgrades/mods/fusionbundles/rarelvl2fusionbundle": { + "value": "40 Endo" + }, + "/lotus/storeitems/upgrades/mods/fusionbundles/rarelvl3fusionbundle": { + "value": "55 Endo" + }, + "/lotus/storeitems/upgrades/mods/fusionbundles/rarelvl4fusionbundle": { + "value": "65 Endo" + }, + "/lotus/storeitems/upgrades/mods/fusionbundles/rarelvl5fusionbundle": { + "value": "80 Endo" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponarmorpiercingdamagemodbeginner": { + "value": "Sundering Strike" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponcritchancemodbeginner": { + "value": "True Steel" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponcritdamagemodbeginner": { + "value": "Organ Shatter" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponcritfireratebonusmodbeginner": { + "value": "Berserker" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponelectricitydamagemodbeginner": { + "value": "Shocking Touch" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponfiredamagemodbeginner": { + "value": "Molten Impact" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponfireratemodbeginner": { + "value": "Fury" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponfreezedamagemodbeginner": { + "value": "North Wind" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponglaivepowerthrowmodbeginner": { + "value": "Power Throw" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponglaivespeedmodbeginner": { + "value": "Whirlwind" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponimpactdamagemodbeginner": { + "value": "Heavy Trauma" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponmeleechannelingefficiencymodbeginner": { + "value": "Reflex Coil" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponmeleedamagemodbeginner": { + "value": "Pressure Point" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponmeleefactiondamagecorpusbeginner": { + "value": "Smite Corpus" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponmeleefactiondamagegrineerbeginner": { + "value": "Smite Grineer" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponmeleefactiondamageinfestedbeginner": { + "value": "Smite Infested" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponslashdamagemodbeginner": { + "value": "Jagged Edge" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weaponstunchancemodbeginner": { + "value": "Melee Prowess" + }, + "/lotus/storeitems/upgrades/mods/melee/beginner/weapontoxindamagemodbeginner": { + "value": "Fever Strike" + }, + "/lotus/storeitems/upgrades/mods/melee/channel/channelcritsmod": { + "value": "True Punishment" + }, + "/lotus/storeitems/upgrades/mods/melee/channel/channelfireratemod": { + "value": "Quickening" + }, + "/lotus/storeitems/upgrades/mods/melee/channel/channelparrystaminaredmod": { + "value": "Warriors Grip" + }, + "/lotus/storeitems/upgrades/mods/melee/channel/channelstatusmod": { + "value": "Enduring Strike" + }, + "/lotus/storeitems/upgrades/mods/melee/channel/channelvampiremod": { + "value": "Life Strike" + }, + "/lotus/storeitems/upgrades/mods/melee/dualstat/corrupteddamagespeedmod": { + "value": "Spoiled Strike" + }, + "/lotus/storeitems/upgrades/mods/melee/dualstat/corruptedheavydamagechargespeedmod": { + "value": "Corrupt Charge" + }, + "/lotus/storeitems/upgrades/mods/melee/dualstat/electeventmeleemod": { + "value": "Voltaic Strike" + }, + "/lotus/storeitems/upgrades/mods/melee/dualstat/fireeventmeleemod": { + "value": "Volcanic Edge" + }, + "/lotus/storeitems/upgrades/mods/melee/dualstat/focusenergymod": { + "value": "Focus Energy" + }, + "/lotus/storeitems/upgrades/mods/melee/dualstat/iceeventmeleemod": { + "value": "Vicious Frost" + }, + "/lotus/storeitems/upgrades/mods/melee/dualstat/poisoneventmeleemod": { + "value": "Virulent Scourge" + }, + "/lotus/storeitems/upgrades/mods/melee/dualstat/rendingstrikemod": { + "value": "Rending Strike" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponarmorpiercingdamagemodexpert": { + "value": "Primed Sundering Strike" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponcritchancemodexpert": { + "value": "Primed True Steel" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponcritdamagemodexpert": { + "value": "Primed Organ Shatter" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponcritfireratebonusmodexpert": { + "value": "Primed Berserker" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponelectricitydamagemodexpert": { + "value": "Primed Shocking Touch" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponfiredamagemodexpert": { + "value": "Primed Molten Impact" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponfireratemodexpert": { + "value": "Primed Fury" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponfreezedamagemodexpert": { + "value": "Primed North Wind" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponglaivepowerthrowmodexpert": { + "value": "Primed Power Throw" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponglaivereflectiondecreasemodexpert": { + "value": "Primed Quick Return" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponglaivereflectionincreasemodexpert": { + "value": "Primed Rebound" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponglaivespeedmodexpert": { + "value": "Primed Whirlwind" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponimpactdamagemodexpert": { + "value": "Primed Heavy Trauma" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponmeleechannelingefficiencymodexpert": { + "value": "Primed Reflex Coil" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponmeleedamagemodexpert": { + "value": "Primed Pressure Point" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponmeleefactiondamagecorpusexpert": { + "value": "Primed Smite Corpus" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponmeleefactiondamagegrineerexpert": { + "value": "Primed Smite Grineer" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponmeleefactiondamageinfestedexpert": { + "value": "Primed Smite Infested" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponmeleefinisherdamagemodexpert": { + "value": "Primed Finishing Touch" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponmeleerangeincmodexpert": { + "value": "Primed Reach" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponpowerdamagemodexpert": { + "value": "Primed Energy Channel" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponslashdamagemodexpert": { + "value": "Primed Jagged Edge" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weaponstunchancemodexpert": { + "value": "Primed Melee Prowess" + }, + "/lotus/storeitems/upgrades/mods/melee/expert/weapontoxindamagemodexpert": { + "value": "Primed Fever Strike" + }, + "/lotus/storeitems/upgrades/mods/melee/intermediate/weaponglaivereflectiondecreasemodintermediate": { + "value": "Quick Return" + }, + "/lotus/storeitems/upgrades/mods/melee/intermediate/weaponglaivereflectionincreasemodintermediate": { + "value": "Rebound" + }, + "/lotus/storeitems/upgrades/mods/melee/intermediate/weaponmeleechannelingefficiencyemodintermediate": { + "value": "Reflex Coil" + }, + "/lotus/storeitems/upgrades/mods/melee/intermediate/weaponmeleefinisherdamagemodintermediate": { + "value": "Finishing Touch" + }, + "/lotus/storeitems/upgrades/mods/melee/intermediate/weaponmeleerangeincmodintermediate": { + "value": "Reach" + }, + "/lotus/storeitems/upgrades/mods/melee/intermediate/weaponpowerdamagemodintermediate": { + "value": "Energy Channel" + }, + "/lotus/storeitems/upgrades/mods/melee/intermediate/weaponstunchancemodintermediate": { + "value": "Melee Prowess" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponarmorpiercingdamagemod": { + "value": "Sundering Strike" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponcritchancemod": { + "value": "True Steel" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponcritdamagemod": { + "value": "Organ Shatter" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponcritfireratebonusmod": { + "value": "Berserker" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponelectricitydamagemod": { + "value": "Shocking Touch" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponeventmeleeimpactdamagemod": { + "value": "Collision Force" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponeventpuncturedamagemod": { + "value": "Auger Strike" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponeventslashdamagemod": { + "value": "Buzz Kill" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponfiredamagemod": { + "value": "Molten Impact" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponfireratemod": { + "value": "Fury" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponfreezedamagemod": { + "value": "North Wind" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponglaivepowerthrowmod": { + "value": "Power Throw" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponglaivereflectiondecreasemod": { + "value": "Quick Return" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponglaivereflectionincreasemod": { + "value": "Rebound" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponglaivespeedmod": { + "value": "Whirlwind" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponimpactdamagemod": { + "value": "Heavy Trauma" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponmeleechargeratemod": { + "value": "Reflex Coil" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponmeleedamagemod": { + "value": "Pressure Point" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponmeleefactiondamagecorpus": { + "value": "Smite Corpus" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponmeleefactiondamagegrineer": { + "value": "Smite Grineer" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponmeleefactiondamageinfested": { + "value": "Smite Infested" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponmeleefinisherdamagemod": { + "value": "Finishing Touch" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponmeleeheavydamagemod": { + "value": "Killing Blow" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponmeleerangeincmod": { + "value": "Reach" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponpowerdamagemod": { + "value": "Energy Channel" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponproctimemod": { + "value": "Lasting Sting" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponslashdamagemod": { + "value": "Jagged Edge" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponstaminabonusmod": { + "value": "Second Wind" + }, + "/lotus/storeitems/upgrades/mods/melee/weaponstunchancemod": { + "value": "Melee Prowess" + }, + "/lotus/storeitems/upgrades/mods/melee/weapontoxindamagemod": { + "value": "Fever Strike" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponammomaxmodbeginner": { + "value": "Trick Mag" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponarmorpiercingdamagemodbeginner": { + "value": "No Return" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponclipmaxmodbeginner": { + "value": "Slip Magazine" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponcritchancemodbeginner": { + "value": "Pistol Gambit" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponcritdamagemodbeginner": { + "value": "Target Cracker" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weapondamageamountmodbeginner": { + "value": "Hornet Strike" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponelectricitydamagemodbeginner": { + "value": "Convulsion" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponfiredamagemodbeginner": { + "value": "Heated Charge" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponfireiterationsmodbeginner": { + "value": "Barrel Diffusion" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponfireratemodbeginner": { + "value": "Gunslinger" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponfreezedamagemodbeginner": { + "value": "Deep Freeze" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponimpactdamagemodbeginner": { + "value": "Concussion Rounds" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponpistolfactiondamagecorpusbeginner": { + "value": "Expel Corpus" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponpistolfactiondamagegrineerbeginner": { + "value": "Expel Grineer" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponpistolfactiondamageinfestedbeginner": { + "value": "Expel Infested" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponpuncturedepthmodbeginner": { + "value": "Seeker" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponreloadspeedmodbeginner": { + "value": "Quickdraw" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponslashdamagemodbeginner": { + "value": "Razor Shot" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weaponstatuschancemodbeginner": { + "value": "Sure Shot" + }, + "/lotus/storeitems/upgrades/mods/pistol/beginner/weapontoxindamagemodbeginner": { + "value": "Pathogen Rounds" + }, + "/lotus/storeitems/upgrades/mods/pistol/dualstat/corruptedcritchancefireratepistol": { + "value": "Creeping Bullseye" + }, + "/lotus/storeitems/upgrades/mods/pistol/dualstat/corruptedcritdamagepistol": { + "value": "Hollow Point" + }, + "/lotus/storeitems/upgrades/mods/pistol/dualstat/corrupteddamagerecoilpistol": { + "value": "Magnum Force" + }, + "/lotus/storeitems/upgrades/mods/pistol/dualstat/corruptedfireratedamagepistol": { + "value": "Anemic Agility" + }, + "/lotus/storeitems/upgrades/mods/pistol/dualstat/corruptedmaxclipreloadspeedpistol": { + "value": "Tainted Clip" + }, + "/lotus/storeitems/upgrades/mods/pistol/dualstat/electeventpistolmod": { + "value": "Jolt" + }, + "/lotus/storeitems/upgrades/mods/pistol/dualstat/fireeventpistolmod": { + "value": "Scorch" + }, + "/lotus/storeitems/upgrades/mods/pistol/dualstat/grindermod": { + "value": "Lethal Torrent" + }, + "/lotus/storeitems/upgrades/mods/pistol/dualstat/iceeventpistolmod": { + "value": "Frostbite" + }, + "/lotus/storeitems/upgrades/mods/pistol/dualstat/icestormmod": { + "value": "Ice Storm" + }, + "/lotus/storeitems/upgrades/mods/pistol/dualstat/poisoneventpistolmod": { + "value": "Pistol Pestilence" + }, + "/lotus/storeitems/upgrades/mods/pistol/dualstat/stunningspeedmod": { + "value": "Stunning Speed" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/primedweaponcritdamagemod": { + "value": "Primed Target Cracker" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponammomaxmodexpert": { + "value": "Trick Mag" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponarmorpiercingdamagemodexpert": { + "value": "No Return" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponclipmaxmodexpert": { + "value": "Primed Slip Magazine" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponcritchancemodbeginnerexpert": { + "value": "Primed Pistol Gambit" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponcritdamagemodexpert": { + "value": "Target Cracker" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponelectricitydamagemodexpert": { + "value": "Convulsion" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponfiredamagemodexpert": { + "value": "Primed Heated Charge" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponfireiterationsmodexpert": { + "value": "Barrel Diffusion" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponfireratemodexpert": { + "value": "Primed Gunslinger" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponfreezedamagemodexpert": { + "value": "Primed Deep Freeze" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponimpactdamagemodexpert": { + "value": "Primed Concussion Rounds" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponnoisereductionmodexpert": { + "value": "Primed Suppress" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponpistolconvertammomodexpert": { + "value": "Primed Pistol Ammo Mutation" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponpistolfactiondamagecorpusexpert": { + "value": "Expel Corpus" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponpistolfactiondamagegrineerexpert": { + "value": "Expel Grineer" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponpistolfactiondamageinfestedexpert": { + "value": "Expel Infested" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponpistolzoomfovmodexpert": { + "value": "Hawk Eye" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponpuncturedepthmodexpert": { + "value": "Seeker" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponrecoilreductionmodexpert": { + "value": "Steady Hands" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponreloadspeedmodexpert": { + "value": "Quickdraw" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponslashdamagemodexpert": { + "value": "Razor Shot" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weaponstatuschancemodexpert": { + "value": "Sure Shot" + }, + "/lotus/storeitems/upgrades/mods/pistol/expert/weapontoxindamagemodexpert": { + "value": "Pathogen Rounds" + }, + "/lotus/storeitems/upgrades/mods/pistol/intermediate/weapondamageamountmodintermediate": { + "value": "Hornet Strike" + }, + "/lotus/storeitems/upgrades/mods/pistol/intermediate/weaponnoisereductionmodintermediate": { + "value": "Suppress" + }, + "/lotus/storeitems/upgrades/mods/pistol/intermediate/weaponpistolconvertammomodintermediate": { + "value": "Pistol Ammo Mutation" + }, + "/lotus/storeitems/upgrades/mods/pistol/intermediate/weaponpistolzoomfovmodintermediate": { + "value": "Hawk Eye" + }, + "/lotus/storeitems/upgrades/mods/pistol/intermediate/weaponrecoilreductionmodintermediate": { + "value": "Steady Hands" + }, + "/lotus/storeitems/upgrades/mods/pistol/intermediate/weaponstatuschancemodintermediate": { + "value": "Sure Shot" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponammomaxmod": { + "value": "Trick Mag" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponarmorpiercingdamagemod": { + "value": "No Return" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponbeamdistancemod": { + "value": "Ruinous Extension" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponclipmaxmod": { + "value": "Slip Magazine" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponcritchancemod": { + "value": "Pistol Gambit" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponcritdamagemod": { + "value": "Target Cracker" + }, + "/lotus/storeitems/upgrades/mods/pistol/weapondamageamountmod": { + "value": "Hornet Strike" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponelectricitydamagemod": { + "value": "Convulsion" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponeventpistolimpactdamagemod": { + "value": "Pummel" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponeventpuncturedamagemod": { + "value": "Bore" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponeventslashdamagemod": { + "value": "Maim" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponfiredamagemod": { + "value": "Heated Charge" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponfireiterationsmod": { + "value": "Barrel Diffusion" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponfireratemod": { + "value": "Gunslinger" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponfreezedamagemod": { + "value": "Deep Freeze" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponimpactdamagemod": { + "value": "Concussion Rounds" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponnoisereductionmod": { + "value": "Suppress" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponpistolconvertammomod": { + "value": "Pistol Ammo Mutation" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponpistolfactiondamagecorpus": { + "value": "Expel Corpus" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponpistolfactiondamagegrineer": { + "value": "Expel Grineer" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponpistolfactiondamageinfested": { + "value": "Expel Infested" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponpistolzoomfovmod": { + "value": "Hawk Eye" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponproctimemod": { + "value": "Perpetual Agony" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponprojectilespeedmod": { + "value": "Lethal Momentum" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponpuncturedepthmod": { + "value": "Seeker" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponrecoilreductionmod": { + "value": "Steady Hands" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponreloadspeedmod": { + "value": "Quickdraw" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponslashdamagemod": { + "value": "Razor Shot" + }, + "/lotus/storeitems/upgrades/mods/pistol/weaponstunchancemod": { + "value": "Sure Shot" + }, + "/lotus/storeitems/upgrades/mods/pistol/weapontoxindamagemod": { + "value": "Pathogen Rounds" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/melee/abilitydamageblockmod": { + "value": "Stand Ground" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/melee/explodeonmeleedeath": { + "value": "Explosive Demise" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/melee/meleeautotargetbonus": { + "value": "Martial Fury" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/melee/meleestaminadamagebonus": { + "value": "[Placeholder] Stamina Damage" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/melee/meleevictimstaminadrain": { + "value": "Relentless Assault" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/pistol/fasterreloadmorerecoilpistolmod": { + "value": "Loose Magazine" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/pistol/highervelocitylessaccuratepistolmod": { + "value": "Blind Shot" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/pistol/holsterspeedbonusmod": { + "value": "Reflex Draw" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/pistol/largermaglongerreloadpistolmod": { + "value": "Full Capacity" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/pistol/lessrecoilsmallermagpistolmod": { + "value": "Hydraulic Barrel" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/pistol/marktargetadddamagemod": { + "value": "Tactical Espionage" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/pistol/marktargetpistolmod": { + "value": "Night Stalker" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/pistol/passivereloadmod": { + "value": "Eject Magazine" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/pistol/restorehealthonkillmod": { + "value": "Recuperate" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/pistol/restoreshieldsonkillmod": { + "value": "Calculated Victory" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/rifle/fasterreloadmorerecoilriflemod": { + "value": "Loose Hatch" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/rifle/highervelocitylessaccurateriflemod": { + "value": "Lucky Shot" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/rifle/holsterspeedbonusmod": { + "value": "Twitch" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/rifle/largermaglongerreloadriflemod": { + "value": "Maximum Capacity" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/rifle/lessrecoilsmallermagriflemod": { + "value": "Hydraulic Gauge" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/rifle/marktargetadddamagemod": { + "value": "Strategic Pursuit" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/rifle/marktargetriflemod": { + "value": "Apex Predator" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/rifle/passivereloadmod": { + "value": "Tactical Reload" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/rifle/restorehealthonkillmod": { + "value": "Recover" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/rifle/restoreshieldsonkillmod": { + "value": "Vanquished Prey" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/shotgun/fasterreloadmorerecoilshotgunmod": { + "value": "Loose Chamber" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/shotgun/holsterspeedbonusmod": { + "value": "Soft Hands" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/shotgun/largermaglongerreloadshotgunmod": { + "value": "Loaded Capacity" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/shotgun/lessrecoilsmallermagshotgunmod": { + "value": "Hydraulic Chamber" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/shotgun/marktargetadddamagemod": { + "value": "Focused Assault" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/shotgun/marktargetshotgunmod": { + "value": "Bounty Hunter" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/shotgun/passivereloadmod": { + "value": "Lock And Load" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/shotgun/restorehealthonkillmod": { + "value": "Momentary Pause" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/shotgun/restoreshieldsonkillmod": { + "value": "Prize Kill" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/warframe/abilitycastingdamageresistance": { + "value": "Perseverance" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/warframe/avatarspawnenergymod": { + "value": "Competitive Advantage" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/warframe/effectonfullenergymod": { + "value": "Overcharge Detectors" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/warframe/energyonfullshieldregenmod": { + "value": "Surplus Diverters" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/warframe/energyonkill": { + "value": "Follow Through" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/warframe/reduceshieldrechargedelaywarframe": { + "value": "Quick Charge" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/warframe/staminaslide": { + "value": "Zero Friction" + }, + "/lotus/storeitems/upgrades/mods/pvpmods/warframe/wallclingmod": { + "value": "Covert Recon" + }, + "/lotus/storeitems/upgrades/mods/randomized/lotusmeleerandommodrare": { + "value": "Melee Riven Mod" + }, + "/lotus/storeitems/upgrades/mods/randomized/lotuspistolrandommodrare": { + "value": "Pistol Riven Mod" + }, + "/lotus/storeitems/upgrades/mods/randomized/lotusriflerandommodrare": { + "value": "Rifle Riven Mod" + }, + "/lotus/storeitems/upgrades/mods/randomized/lotusshotgunrandommodrare": { + "value": "Shotgun Riven Mod" + }, + "/lotus/storeitems/upgrades/mods/randomized/playermeleeweaponrandommodrare": { + "value": "Veiled Melee Riven Mod" + }, + "/lotus/storeitems/upgrades/mods/randomized/playerpistolweaponrandommodrare": { + "value": "Veiled Pistol Riven Mod" + }, + "/lotus/storeitems/upgrades/mods/randomized/playerrifleweaponrandommodrare": { + "value": "Veiled Rifle Riven Mod" + }, + "/lotus/storeitems/upgrades/mods/randomized/playershotgunweaponrandommodrare": { + "value": "Veiled Shotgun Riven Mod" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponammomaxmodbeginner": { + "value": "Ammo Drum" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponarmorpiercingdamagemodbeginner": { + "value": "Piercing Hit" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponclipmaxmodbeginner": { + "value": "Magazine Warp" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponcritchancemodbeginner": { + "value": "Point Strike" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponcritdamagemodbeginner": { + "value": "Vital Sense" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weapondamageamountmodbeginner": { + "value": "Serration" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponelectricitydamagemodbeginner": { + "value": "Stormbringer" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponfactiondamagecorpusbeginner": { + "value": "Bane Of Corpus" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponfactiondamagegrineerbeginner": { + "value": "Bane Of Grineer" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponfactiondamageinfestedbeginner": { + "value": "Bane Of Infested" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponfiredamagemodbeginner": { + "value": "Hellfire" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponfireiterationsmodbeginner": { + "value": "Split Chamber" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponfireratemodbeginner": { + "value": "Speed Trigger" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponfreezedamagemodbeginner": { + "value": "Cryo Rounds" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponimpactdamagemodbeginner": { + "value": "Rupture" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponpuncturedepthmodbeginner": { + "value": "Metal Auger" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponreloadspeedmodbeginner": { + "value": "Fast Hands" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponslashdamagemodbeginner": { + "value": "Sawtooth Clip" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weaponstatuschancemodbeginner": { + "value": "Rifle Aptitude" + }, + "/lotus/storeitems/upgrades/mods/rifle/beginner/weapontoxindamagemodbeginner": { + "value": "Infected Clip" + }, + "/lotus/storeitems/upgrades/mods/rifle/bowexplosionchancemod": { + "value": "Thunderbolt" + }, + "/lotus/storeitems/upgrades/mods/rifle/dualstat/corruptedcritratefireraterifle": { + "value": "Critical Delay" + }, + "/lotus/storeitems/upgrades/mods/rifle/dualstat/corrupteddamagerecoilrifle": { + "value": "Heavy Caliber" + }, + "/lotus/storeitems/upgrades/mods/rifle/dualstat/corruptedfireratedamagerifle": { + "value": "Vile Acceleration" + }, + "/lotus/storeitems/upgrades/mods/rifle/dualstat/corruptedmaxclipreloadspeedrifle": { + "value": "Tainted Mag" + }, + "/lotus/storeitems/upgrades/mods/rifle/dualstat/corruptedrecoilfireraterifle": { + "value": "Vile Precision" + }, + "/lotus/storeitems/upgrades/mods/rifle/dualstat/electeventriflemod": { + "value": "High Voltage" + }, + "/lotus/storeitems/upgrades/mods/rifle/dualstat/fireeventriflemod": { + "value": "Thermite Rounds" + }, + "/lotus/storeitems/upgrades/mods/rifle/dualstat/hammershotmod": { + "value": "Hammer Shot" + }, + "/lotus/storeitems/upgrades/mods/rifle/dualstat/iceeventriflemod": { + "value": "Rime Rounds" + }, + "/lotus/storeitems/upgrades/mods/rifle/dualstat/poisoneventriflemod": { + "value": "Malignant Force" + }, + "/lotus/storeitems/upgrades/mods/rifle/dualstat/shredmod": { + "value": "Shred" + }, + "/lotus/storeitems/upgrades/mods/rifle/dualstat/wildfiremod": { + "value": "Wildfire" + }, + "/lotus/storeitems/upgrades/mods/rifle/eventsniperreloaddamagemod": { + "value": "Primed Chamber" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/bowexplosionchancemodexpert": { + "value": "Thunderbolt" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/primedweaponfactiondamagecorpus": { + "value": "Primed Bane of Corpus" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/primedweaponfactiondamagecorrupted": { + "value": "Primed Bane of Corrupted" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/primedweaponfactiondamagegrineer": { + "value": "Primed Bane of Grineer" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/primedweaponfactiondamageinfested": { + "value": "Primed Bane of Infested" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/sniperreloaddamagemodexpert": { + "value": "Primed Charged Chamber" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponammomaxmodexpert": { + "value": "Ammo Drum" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponarmorpiercingdamagemodexpert": { + "value": "Piercing Hit" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponbowconvertammomodexpert": { + "value": "Arrow Mutation" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponclipmaxmodexpert": { + "value": "Primed Magazine Warp" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponcritchancemodexpert": { + "value": "Point Strike" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponcritdamagemodexpert": { + "value": "Vital Sense" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponelectricitydamagemodexpert": { + "value": "Stormbringer" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponfactiondamagecorpusexpert": { + "value": "Bane Of Corpus" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponfactiondamagegrineerexpert": { + "value": "Bane Of Grineer" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponfactiondamageinfestedexpert": { + "value": "Bane Of Infested" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponfiredamagemodexpert": { + "value": "Hellfire" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponfireiterationsmodexpert": { + "value": "Split Chamber" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponfireratemodexpert": { + "value": "Speed Trigger" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponfreezedamagemodexpert": { + "value": "Primed Cryo Rounds" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponimpactdamagemodexpert": { + "value": "Rupture" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponincreaseradialexplosionmodexpert": { + "value": "Firestorm" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponnoisereductionmodexpert": { + "value": "Hush" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponpuncturedepthmodexpert": { + "value": "Metal Auger" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponrecoilreductionmodexpert": { + "value": "Stabilizer" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponreloadspeedmodexpert": { + "value": "Primed Fast Hands" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponrifleconvertammomodexpert": { + "value": "Primed Rifle Ammo Mutation" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponslashdamagemodexpert": { + "value": "Sawtooth Clip" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponsnipersconvertammomodexpert": { + "value": "Sniper Ammo Mutation" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponstatuschancemodexpert": { + "value": "Rifle Aptitude" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weapontoxindamagemodexpert": { + "value": "Infected Clip" + }, + "/lotus/storeitems/upgrades/mods/rifle/expert/weaponzoomfovmodexpert": { + "value": "Eagle Eye" + }, + "/lotus/storeitems/upgrades/mods/rifle/intermediate/bowexplosionchancemodintermediate": { + "value": "Thunderbolt" + }, + "/lotus/storeitems/upgrades/mods/rifle/intermediate/sniperreloaddamagemodintermediate": { + "value": "Charged Chamber" + }, + "/lotus/storeitems/upgrades/mods/rifle/intermediate/weaponbowconvertammomodintermediate": { + "value": "Arrow Mutation" + }, + "/lotus/storeitems/upgrades/mods/rifle/intermediate/weapondamageamountmodintermediate": { + "value": "Serration" + }, + "/lotus/storeitems/upgrades/mods/rifle/intermediate/weaponincreaseradialexplosionmodintermediate": { + "value": "Firestorm" + }, + "/lotus/storeitems/upgrades/mods/rifle/intermediate/weaponnoisereductionmodintermediate": { + "value": "Hush" + }, + "/lotus/storeitems/upgrades/mods/rifle/intermediate/weaponrecoilreductionmodintermediate": { + "value": "Stabilizer" + }, + "/lotus/storeitems/upgrades/mods/rifle/intermediate/weaponrifleconvertammomodintermediate": { + "value": "Rifle Ammo Mutation" + }, + "/lotus/storeitems/upgrades/mods/rifle/intermediate/weaponsnipersconvertammomodintermediate": { + "value": "Sniper Ammo Mutation" + }, + "/lotus/storeitems/upgrades/mods/rifle/intermediate/weaponstatuschancemodintermediate": { + "value": "Rifle Aptitude" + }, + "/lotus/storeitems/upgrades/mods/rifle/intermediate/weaponzoomfovmodintermediate": { + "value": "Eagle Eye" + }, + "/lotus/storeitems/upgrades/mods/rifle/sniperreloaddamagemod": { + "value": "Charged Chamber" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponammomaxmod": { + "value": "Ammo Drum" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponarmorpiercingdamagemod": { + "value": "Piercing Hit" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponbeamdistancemod": { + "value": "Sinister Reach" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponbowconvertammomod": { + "value": "Arrow Mutation" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponclipmaxmod": { + "value": "Magazine Warp" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponcritchancemod": { + "value": "Point Strike" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponcritdamagemod": { + "value": "Vital Sense" + }, + "/lotus/storeitems/upgrades/mods/rifle/weapondamageamountmod": { + "value": "Serration" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponelectricitydamagemod": { + "value": "Stormbringer" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponeventpuncturedamagemod": { + "value": "Piercing Caliber" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponeventrifleimpactdamagemod": { + "value": "Crash Course" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponeventslashdamagemod": { + "value": "Fanged Fusillade" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponfactiondamagecorpus": { + "value": "Bane Of Corpus" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponfactiondamagegrineer": { + "value": "Bane Of Grineer" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponfactiondamageinfested": { + "value": "Bane Of Infested" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponfiredamagemod": { + "value": "Hellfire" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponfireiterationsmod": { + "value": "Split Chamber" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponfireratemod": { + "value": "Speed Trigger" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponfreezedamagemod": { + "value": "Cryo Rounds" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponimpactdamagemod": { + "value": "Rupture" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponincreaseradialexplosionmod": { + "value": "Firestorm" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponnoisereductionmod": { + "value": "Hush" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponproctimemod": { + "value": "Continuous Misery" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponprojectilespeedmod": { + "value": "Terminal Velocity" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponpuncturedepthmod": { + "value": "Metal Auger" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponrecoilreductionmod": { + "value": "Stabilizer" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponreloadspeedmod": { + "value": "Fast Hands" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponrifleconvertammomod": { + "value": "Rifle Ammo Mutation" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponslashdamagemod": { + "value": "Sawtooth Clip" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponsnipersconvertammomod": { + "value": "Sniper Ammo Mutation" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponstunchancemod": { + "value": "Rifle Aptitude" + }, + "/lotus/storeitems/upgrades/mods/rifle/weapontoxindamagemod": { + "value": "Infected Clip" + }, + "/lotus/storeitems/upgrades/mods/rifle/weaponzoomfovmod": { + "value": "Eagle Eye" + }, + "/lotus/storeitems/upgrades/mods/sentinel/kubrow/kubrowclonedfinishermod": { + "value": "Savagery" + }, + "/lotus/storeitems/upgrades/mods/sentinel/kubrow/kubrowcritmod": { + "value": "Bite" + }, + "/lotus/storeitems/upgrades/mods/sentinel/kubrow/kubrowfinishermod": { + "value": "Ferocity" + }, + "/lotus/storeitems/upgrades/mods/sentinel/kubrow/kubrowlinkarmourmaxmod": { + "value": "Link Armor" + }, + "/lotus/storeitems/upgrades/mods/sentinel/kubrow/kubrowlinkhealthmaxmod": { + "value": "Link Health" + }, + "/lotus/storeitems/upgrades/mods/sentinel/kubrow/kubrowlinkshieldmaxmod": { + "value": "Link Shields" + }, + "/lotus/storeitems/upgrades/mods/sentinel/kubrow/kubrowmasterbleedoutmod": { + "value": "Loyal Companion" + }, + "/lotus/storeitems/upgrades/mods/sentinel/kubrow/kubrowmeleedamagemod": { + "value": "Maul" + }, + "/lotus/storeitems/upgrades/mods/sentinel/kubrow/kubrowpackleadermod": { + "value": "Pack Leader" + }, + "/lotus/storeitems/upgrades/mods/sentinel/kubrow/kubrowshieldrechargeratemod": { + "value": "Hastened Deflection" + }, + "/lotus/storeitems/upgrades/mods/sentinel/sentinelarmourmod": { + "value": "Metal Fiber" + }, + "/lotus/storeitems/upgrades/mods/sentinel/sentineldropchancemod": { + "value": "Spare Parts" + }, + "/lotus/storeitems/upgrades/mods/sentinel/sentinelexplosionmod": { + "value": "Self Destruct" + }, + "/lotus/storeitems/upgrades/mods/sentinel/sentinelhealthmaxmod": { + "value": "Enhanced Vitality" + }, + "/lotus/storeitems/upgrades/mods/sentinel/sentinellootradarenemyradarmod": { + "value": "Animal Instinct" + }, + "/lotus/storeitems/upgrades/mods/sentinel/sentineloverheatdamagemod": { + "value": "Fired Up" + }, + "/lotus/storeitems/upgrades/mods/sentinel/sentinelshieldmaxmod": { + "value": "Calculated Redirection" + }, + "/lotus/storeitems/upgrades/mods/sentinel/sentinelshieldrechargeratemod": { + "value": "Accelerated Deflection" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponammomaxmodbeginner": { + "value": "Shell Compression" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponarmorpiercingdamagemodbeginner": { + "value": "Flechette" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponclipmaxmodbeginner": { + "value": "Ammo Stock" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponcritchancemodbeginner": { + "value": "Blunderbuss" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponcritdamagemodbeginner": { + "value": "Ravage" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weapondamageamountmodbeginner": { + "value": "Point Blank" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponelectricitydamagemodbeginner": { + "value": "Charged Shell" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponfiredamagemodbeginner": { + "value": "Incendiary Coat" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponfireiterationsmodbeginner": { + "value": "Hells Chamber" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponfireratemodbeginner": { + "value": "Shotgun Spazz" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponfreezedamagemodbeginner": { + "value": "Chilling Grasp" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponimpactdamagemodbeginner": { + "value": "Disruptor" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponpuncturedepthmodbeginner": { + "value": "Seeking Force" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponreloadspeedmodbeginner": { + "value": "Tactical Pump" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponshotgunfactiondamagecorpusbeginner": { + "value": "Cleanse Corpus" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponshotgunfactiondamagegrineerbeginner": { + "value": "Cleanse Grineer" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponshotgunfactiondamageinfestedbeginner": { + "value": "Cleanse Infested" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponslashdamagemodbeginner": { + "value": "Shredder" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weaponstunchancemodbeginner": { + "value": "Shotgun Savvy" + }, + "/lotus/storeitems/upgrades/mods/shotgun/beginner/weapontoxindamagemodbeginner": { + "value": "Contagious Spread" + }, + "/lotus/storeitems/upgrades/mods/shotgun/dualstat/acceleratedblastmod": { + "value": "Accelerated Blast" + }, + "/lotus/storeitems/upgrades/mods/shotgun/dualstat/blazemod": { + "value": "Blaze" + }, + "/lotus/storeitems/upgrades/mods/shotgun/dualstat/corruptedaccuracyfirerateshotgun": { + "value": "Tainted Shell" + }, + "/lotus/storeitems/upgrades/mods/shotgun/dualstat/corruptedcritchancefirerateshotgun": { + "value": "Critical Deceleration" + }, + "/lotus/storeitems/upgrades/mods/shotgun/dualstat/corrupteddamageaccuracyshotgun": { + "value": "Vicious Spread" + }, + "/lotus/storeitems/upgrades/mods/shotgun/dualstat/corruptedfireratedamageshotgun": { + "value": "Frail Momentum" + }, + "/lotus/storeitems/upgrades/mods/shotgun/dualstat/corruptedmaxclipreloadspeedshotgun": { + "value": "Burdened Magazine" + }, + "/lotus/storeitems/upgrades/mods/shotgun/dualstat/electeventshotgunmod": { + "value": "Shell Shock" + }, + "/lotus/storeitems/upgrades/mods/shotgun/dualstat/fireeventshotgunmod": { + "value": "Scattering Inferno" + }, + "/lotus/storeitems/upgrades/mods/shotgun/dualstat/iceeventshotgunmod": { + "value": "Frigid Blast" + }, + "/lotus/storeitems/upgrades/mods/shotgun/dualstat/poisoneventshotgunmod": { + "value": "Toxic Barrage" + }, + "/lotus/storeitems/upgrades/mods/shotgun/dualstat/reloadspeedpunchthroughmod": { + "value": "Seeking Fury" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponammomaxmodexpert": { + "value": "Shell Compression" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponarmorpiercingdamagemodexpert": { + "value": "Flechette" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponclipmaxmodexpert": { + "value": "Ammo Stock" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponcritchancemodexpert": { + "value": "Blunderbuss" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponcritdamagemodexpert": { + "value": "Primed Ravage" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weapondamageamountmodexpert": { + "value": "Primed Point Blank" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponelectricitydamagemodexpert": { + "value": "Charged Shell" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponfiredamagemodexpert": { + "value": "Incendiary Coat" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponfireiterationsmodexpert": { + "value": "Hells Chamber" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponfireratemodexpert": { + "value": "Shotgun Spazz" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponfreezedamagemodexpert": { + "value": "Chilling Grasp" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponimpactdamagemodexpert": { + "value": "Disruptor" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponpuncturedepthmodexpert": { + "value": "Seeking Force" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponreloadspeedmodexpert": { + "value": "Tactical Pump" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponshotgunconvertammomodexpert": { + "value": "Primed Shotgun Ammo Mutation" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponshotgunfactiondamagecorpusexpert": { + "value": "Cleanse Corpus" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponshotgunfactiondamagegrineerexpert": { + "value": "Cleanse Grineer" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponshotgunfactiondamageinfestedexpert": { + "value": "Cleanse Infested" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponslashdamagemodexpert": { + "value": "Shredder" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weaponstunchancemodexpert": { + "value": "Shotgun Savvy" + }, + "/lotus/storeitems/upgrades/mods/shotgun/expert/weapontoxindamagemodexpert": { + "value": "Contagious Spread" + }, + "/lotus/storeitems/upgrades/mods/shotgun/intermediate/weaponshotgunconvertammomodintermediate": { + "value": "Shotgun Ammo Mutation" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponammomaxmod": { + "value": "Shell Compression" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponarmorpiercingdamagemod": { + "value": "Flechette" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponclipmaxmod": { + "value": "Ammo Stock" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponcritchancemod": { + "value": "Blunderbuss" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponcritdamagemod": { + "value": "Ravage" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weapondamageamountmod": { + "value": "Point Blank" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponelectricitydamagemod": { + "value": "Charged Shell" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponeventpuncturedamagemod": { + "value": "Breach Loader" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponeventshotgunimpactdamagemod": { + "value": "Full Contact" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponeventslashdamagemod": { + "value": "Sweeping Serration" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponfiredamagemod": { + "value": "Incendiary Coat" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponfireiterationsmod": { + "value": "Hells Chamber" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponfireratemod": { + "value": "Shotgun Spazz" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponfreezedamagemod": { + "value": "Chilling Grasp" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponimpactdamagemod": { + "value": "Disruptor" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponproctimemod": { + "value": "Lingering Torment" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponprojectilespeedmod": { + "value": "Fatal Acceleration" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponpuncturedepthmod": { + "value": "Seeking Force" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponreloadspeedmod": { + "value": "Tactical Pump" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponshotgunconvertammomod": { + "value": "Shotgun Ammo Mutation" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponshotgunfactiondamagecorpus": { + "value": "Cleanse Corpus" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponshotgunfactiondamagegrineer": { + "value": "Cleanse Grineer" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponshotgunfactiondamageinfested": { + "value": "Cleanse Infested" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponslashdamagemod": { + "value": "Shredder" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weaponstunchancemod": { + "value": "Shotgun Savvy" + }, + "/lotus/storeitems/upgrades/mods/shotgun/weapontoxindamagemod": { + "value": "Contagious Spread" + }, + "/lotus/storeitems/upgrades/mods/syndicate/acridmod": { + "value": "Toxic Sequence" + }, + "/lotus/storeitems/upgrades/mods/syndicate/ballisticamod": { + "value": "Soaring Truth" + }, + "/lotus/storeitems/upgrades/mods/syndicate/boltomod": { + "value": "Entropy Spike" + }, + "/lotus/storeitems/upgrades/mods/syndicate/burstonprimemod": { + "value": "Gilded Truth" + }, + "/lotus/storeitems/upgrades/mods/syndicate/darkdaggermod": { + "value": "Gleaming Blight" + }, + "/lotus/storeitems/upgrades/mods/syndicate/dualcleaversmod": { + "value": "Justice Blades" + }, + "/lotus/storeitems/upgrades/mods/syndicate/embolistmod": { + "value": "Eroding Blight" + }, + "/lotus/storeitems/upgrades/mods/syndicate/furismod": { + "value": "Winds Of Purity" + }, + "/lotus/storeitems/upgrades/mods/syndicate/grinlokmod": { + "value": "Deadly Sequence" + }, + "/lotus/storeitems/upgrades/mods/syndicate/hekmod": { + "value": "Scattered Justice" + }, + "/lotus/storeitems/upgrades/mods/syndicate/jawswordmod": { + "value": "Blade Of Truth" + }, + "/lotus/storeitems/upgrades/mods/syndicate/kestrelmod": { + "value": "Entropy Flight" + }, + "/lotus/storeitems/upgrades/mods/syndicate/miremod": { + "value": "Toxic Blight" + }, + "/lotus/storeitems/upgrades/mods/syndicate/skanamod": { + "value": "Bright Purity" + }, + "/lotus/storeitems/upgrades/mods/syndicate/sobekmod": { + "value": "Shattering Justice" + }, + "/lotus/storeitems/upgrades/mods/syndicate/spectramod": { + "value": "Sequence Burn" + }, + "/lotus/storeitems/upgrades/mods/syndicate/supramod": { + "value": "Entropy Burst" + }, + "/lotus/storeitems/upgrades/mods/syndicate/vipermod": { + "value": "Stinging Truth" + }, + "/lotus/storeitems/upgrades/mods/syndicate/vulkarmod": { + "value": "Lasting Purity" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/ashmod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/bansheemod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/embermod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/excaliburmod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/frostmod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/hydroidmod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/lokimod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/magmod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/miragemod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/nekrosmod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/novamod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/nyxmod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/oberonmod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/rhinomod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/sarynmod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/trinitymod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/valkyrmod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/vaubanmod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/voltmod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/syndicate/warframes/zephyrmod": { + "value": "[Placeholder] Tbd" + }, + "/lotus/storeitems/upgrades/mods/transmutecores/attacktransmutecore": { + "value": "Madurai Transmute Core" + }, + "/lotus/storeitems/upgrades/mods/transmutecores/basetransmutecore": { + "value": "Transmute Core" + }, + "/lotus/storeitems/upgrades/mods/transmutecores/defensetransmutecore": { + "value": "Vazarin Transmute Core" + }, + "/lotus/storeitems/upgrades/mods/transmutecores/tactictransmutecore": { + "value": "Naramon Transmute Core" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarabilitydurationmod": { + "value": "Continuity" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarabilityefficiencymod": { + "value": "Streamline" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarabilityrangemod": { + "value": "Stretch" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarabilitystrengthmod": { + "value": "Intensify" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatararmourmod": { + "value": "Steel Fiber" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarautoparrymod": { + "value": "Reflex Guard" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarbleedoutdelaymod": { + "value": "Undying Will" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarcastingspeedmod": { + "value": "Natural Talent" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarchancetoloot": { + "value": "Master Thief" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatardamagereductioninair": { + "value": "Aviator" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatardamageresistanceelectricity": { + "value": "Lightning Rod" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatardamageresistancefire": { + "value": "Flame Repellent" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatardamageresistanceice": { + "value": "Insulation" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatardamageresistanceknockdown": { + "value": "Shock Absorbers" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatardamageresistancelaser": { + "value": "Diamond Skin" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatardamageresistancepoison": { + "value": "Antitoxin" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatardamageresistancestun": { + "value": "Resilient Focus" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatardamagetoenergymod": { + "value": "Rage" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarenemyradarmod": { + "value": "Enemy Sense" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarfallingimpactmod": { + "value": "Heavy Impact" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatargroundfiredmgmod": { + "value": "Provoked" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarhealthmaxmod": { + "value": "Vitality" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarknockdownrecoverymod": { + "value": "Handspring" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarknockdownresistancemod": { + "value": "Sure Footed" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarlootradarmod": { + "value": "Thiefs Wit" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarmissionspecificresistanceice": { + "value": "Warm Coat" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarparrymeleemod": { + "value": "Parry" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarparryreflectmod": { + "value": "Reflection" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarpickupbonusmod": { + "value": "Equilibrium" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarpowermaxmod": { + "value": "Flow" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarpowertohealthondeathmod": { + "value": "Quick Thinking" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarproctimemod": { + "value": "Rapid Resilience" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarrevengedamagemelee": { + "value": "Retribution" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarshieldmaxmod": { + "value": "Redirection" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarshieldrechargeratemod": { + "value": "Fast Deflection" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarshieldtostaminamod": { + "value": "Shield Flux" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarslideboostmod": { + "value": "Maglev" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarsprintspeedmod": { + "value": "Rush" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarstaminacostmultipliermod": { + "value": "Acrobat" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarstaminamaxmod": { + "value": "Marathon" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatarstaminarechargeratemod": { + "value": "Quick Rest" + }, + "/lotus/storeitems/upgrades/mods/warframe/avatartimelimitincreasemod": { + "value": "Intruder" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarabilitydurationmodbeginner": { + "value": "Continuity" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarabilityefficiencymodbeginner": { + "value": "Streamline" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarabilityrangemodbeginner": { + "value": "Stretch" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarabilitystrengthmodbeginner": { + "value": "Intensify" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatararmourmodbeginner": { + "value": "Steel Fiber" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarautoparrymodbeginner": { + "value": "Reflex Guard" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatardamageresistanceelectricitybeginner": { + "value": "Lightning Rod" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatardamageresistancefirebeginner": { + "value": "Flame Repellent" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatardamageresistanceicebeginner": { + "value": "Insulation" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatardamageresistancelaserbeginner": { + "value": "Diamond Skin" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatardamageresistancepoisonbeginner": { + "value": "Antitoxin" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarenemyradarmodbeginner": { + "value": "Enemy Sense" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarfallingimpactmodbeginner": { + "value": "Heavy Impact" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatargroundfiredmgmodbeginner": { + "value": "Provoked" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarhealthmaxmodbeginner": { + "value": "Vitality" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarlootradarmodbeginner": { + "value": "Thiefs Wit" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarparrymeleemodbeginner": { + "value": "Parry" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarparryreflectmodbeginner": { + "value": "Reflection" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarpickupbonusmodbeginner": { + "value": "Equilibrium" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarpowermaxmodbeginner": { + "value": "Flow" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarpowertohealthondeathmodbeginner": { + "value": "Quick Thinking" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarshieldmaxmodbeginner": { + "value": "Redirection" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarshieldrechargeratemodbeginner": { + "value": "Fast Deflection" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarslideboostmodbeginner": { + "value": "Maglev" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarsprintspeedmodbeginner": { + "value": "Rush" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarstaminacostmultipliermodbeginner": { + "value": "Acrobat" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarstaminamaxmodbeginner": { + "value": "Marathon" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatarstaminarechargeratemodbeginner": { + "value": "Quick Rest" + }, + "/lotus/storeitems/upgrades/mods/warframe/beginner/avatartimelimitincreasemodbeginner": { + "value": "Intruder" + }, + "/lotus/storeitems/upgrades/mods/warframe/dualstat/constitutionmod": { + "value": "Constitution" + }, + "/lotus/storeitems/upgrades/mods/warframe/dualstat/corrupteddurationrangewarframe": { + "value": "Narrow Minded" + }, + "/lotus/storeitems/upgrades/mods/warframe/dualstat/corruptedefficiencydurationwarframe": { + "value": "Fleeting Expertise" + }, + "/lotus/storeitems/upgrades/mods/warframe/dualstat/corruptedpowerefficiencywarframe": { + "value": "Blind Rage" + }, + "/lotus/storeitems/upgrades/mods/warframe/dualstat/corruptedpowerstrengthpowerdurationwarframe": { + "value": "Transient Fortitude" + }, + "/lotus/storeitems/upgrades/mods/warframe/dualstat/corruptedrangepowerwarframe": { + "value": "Overextended" + }, + "/lotus/storeitems/upgrades/mods/warframe/dualstat/fortitudemod": { + "value": "Fortitude" + }, + "/lotus/storeitems/upgrades/mods/warframe/dualstat/runspeedarmormod": { + "value": "Armored Agility" + }, + "/lotus/storeitems/upgrades/mods/warframe/dualstat/vigormod": { + "value": "Vigor" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarabilitydurationmodexpert": { + "value": "Primed Continuity" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarabilityefficiencymodexpert": { + "value": "Primed Streamline" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarabilityrangemodexpert": { + "value": "Stretch" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarabilitystrengthmodexpert": { + "value": "Intensify" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarbleedoutdelaymodexpert": { + "value": "Undying Will" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarcastingspeedmodexpert": { + "value": "Natural Talent" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarchancetolootexpert": { + "value": "Master Thief" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatardamagereductioninairexpert": { + "value": "Aviator" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatardamageresistanceelectricityexpert": { + "value": "Lightning Rod" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatardamageresistancefireexpert": { + "value": "Flame Repellent" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatardamageresistanceiceexpert": { + "value": "Insulation" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatardamageresistancelaserexpert": { + "value": "Diamond Skin" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatardamageresistancepoisonexpert": { + "value": "Antitoxin" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatardamagetoenergymodexpert": { + "value": "Rage" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarenemyradarmodexpert": { + "value": "Enemy Sense" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarfallingimpactmodexpert": { + "value": "Heavy Impact" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarknockdownrecoverymodexpert": { + "value": "Handspring" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarknockdownresistancemodexpert": { + "value": "Sure Footed" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarlootradarmodexpert": { + "value": "Thiefs Wit" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarmissionspecificresistanceiceexpert": { + "value": "Warm Coat" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarparrymeleemodexpert": { + "value": "Parry" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarparryreflectmodexpert": { + "value": "Reflection" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarpowermaxmodexpert": { + "value": "Primed Flow" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarpowertohealthondeathmodexpert": { + "value": "Quick Thinking" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarrevengedamagemeleeexpert": { + "value": "Retribution" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarshieldrechargeratemodexpert": { + "value": "Fast Deflection" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarshieldtostaminamodexpert": { + "value": "Shield Flux" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarslideboostmodexpert": { + "value": "Maglev" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarsprintspeedmodexpert": { + "value": "Rush" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarstaminacostmultipliermodexpert": { + "value": "Acrobat" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarstaminamaxmodexpert": { + "value": "Marathon" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatarstaminarechargeratemodexpert": { + "value": "Quick Rest" + }, + "/lotus/storeitems/upgrades/mods/warframe/expert/avatartimelimitincreasemodexpert": { + "value": "Intruder" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatararmourmodintermediate": { + "value": "Steel Fiber" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatarautoparrymodintermediate": { + "value": "Reflex Guard" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatarcastingspeedmodintermediate": { + "value": "Natural Talent" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatarchancetolootintermediate": { + "value": "Master Thief" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatardamagereductioninairintermediate": { + "value": "Aviator" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatardamageresistanceknockdownintermediate": { + "value": "Shock Absorbers" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatardamagetoenergymodintermediate": { + "value": "Rage" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatargroundfiredmgmodintermediate": { + "value": "Provoked" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatarhealthmaxmodintermediate": { + "value": "Vitality" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatarknockdownrecoverymodintermediate": { + "value": "Handspring" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatarknockdownresistancemodintermediate": { + "value": "Sure Footed" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatarmissionspecificresistanceiceintermediate": { + "value": "Warm Coat" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatarparrymeleemodintermediate": { + "value": "Parry" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatarpickupbonusmodintermediate": { + "value": "Equilibrium" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatarrevengedamagemeleeintermediate": { + "value": "Retribution" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatarshieldmaxmodintermediate": { + "value": "Redirection" + }, + "/lotus/storeitems/upgrades/mods/warframe/intermediate/avatarshieldtostaminamodintermediate": { + "value": "Shield Flux" + }, + "/lotus/storeitems/upgrades/skins/antimatter/antialthelmet": { + "value": "Arcane Flux Helmet" + }, + "/lotus/storeitems/upgrades/skins/antimatter/antialthelmetstatless": { + "value": "Nova Flux Helmet" + }, + "/lotus/storeitems/upgrades/skins/antimatter/antihelmet": { + "value": "Nova Helmet" + }, + "/lotus/storeitems/upgrades/skins/antimatter/antimatteragileanims": { + "value": "Nova Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/antimatter/antimatternobleanims": { + "value": "Nova Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/antimatter/novaalternateskin": { + "value": "Nova Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/antimatter/novaprimehelmet": { + "value": "Nova Prime Helmet" + }, + "/lotus/storeitems/upgrades/skins/antimatter/novaquantumhelmet": { + "value": "Quantum Nova Helmet" + }, + "/lotus/storeitems/upgrades/skins/antimatter/novaslipstreamhelmet": { + "value": "Nova Slipstream Helmet" + }, + "/lotus/storeitems/upgrades/skins/antimatter/unlockantimatteragile": { + "value": "Nova Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/antimatter/unlockantimatternoble": { + "value": "Nova Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/armor/baroarmour/baroarmoura": { + "value": "Ki'Teer Shoulder Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/baroarmour/baroarmourc": { + "value": "Ki'Teer Chest Plate" + }, + "/lotus/storeitems/upgrades/skins/armor/baroarmour/baroarmourl": { + "value": "Ki'Teer Leg Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/baroarmourtwo/baroarmourtwoa": { + "value": "Ki'Teer Foros Shoulder Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/baroarmourtwo/baroarmourtwoc": { + "value": "Ki'Teer Foros Chest Plate" + }, + "/lotus/storeitems/upgrades/skins/armor/baroarmourtwo/baroarmourtwol": { + "value": "Ki'Teer Foros Leg Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/corpusfencer/crpfncalarmor": { + "value": "Dendra Shoulder Guard" + }, + "/lotus/storeitems/upgrades/skins/armor/corpusfencer/crpfncararmor": { + "value": "Dendra Shoulder Guard" + }, + "/lotus/storeitems/upgrades/skins/armor/corpusfencer/crpfncllarmor": { + "value": "Dendra Leg Guard" + }, + "/lotus/storeitems/upgrades/skins/armor/corpusfencer/crpfnclrarmor": { + "value": "Dendra Leg Guard" + }, + "/lotus/storeitems/upgrades/skins/armor/grineerturbines/grineerturbinesarmleftarmor": { + "value": "Harkonar Spaulders" + }, + "/lotus/storeitems/upgrades/skins/armor/grineerturbines/grineerturbinesarmrightarmor": { + "value": "Harkonar Spaulders" + }, + "/lotus/storeitems/upgrades/skins/armor/grineerturbines/grineerturbineschestarmor": { + "value": "Harkonar Chestguard" + }, + "/lotus/storeitems/upgrades/skins/armor/grineerturbines/grineerturbineslegleftarmor": { + "value": "Harkonar Leg Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/grineerturbines/grineerturbineslegrightarmor": { + "value": "Harkonar Leg Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/halloween2014wings/halloween2014armleftarmor": { + "value": "Naberus" + }, + "/lotus/storeitems/upgrades/skins/armor/halloween2014wings/halloween2014armrightarmor": { + "value": "Naberus" + }, + "/lotus/storeitems/upgrades/skins/armor/infestedfins/infestedfinsarmleftarmor": { + "value": "Iliac Shoulder Plate" + }, + "/lotus/storeitems/upgrades/skins/armor/infestedfins/infestedfinsarmrightarmor": { + "value": "Iliac Shoulder Plate" + }, + "/lotus/storeitems/upgrades/skins/armor/infestedfins/infestedfinschestarmor": { + "value": "Iliac Chest Plate" + }, + "/lotus/storeitems/upgrades/skins/armor/infestedfins/infestedfinslegleftarmor": { + "value": "Iliac Ankle Plate" + }, + "/lotus/storeitems/upgrades/skins/armor/infestedfins/infestedfinslegrightarmor": { + "value": "Iliac Ankle Plate" + }, + "/lotus/storeitems/upgrades/skins/armor/primesetone/primesetonearmleftarmor": { + "value": "Targis Prime Arm Shoulder Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/primesetone/primesetonearmrightarmor": { + "value": "Targis Prime Arm Shoulder Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/primesetone/primesetonechestarmor": { + "value": "Targis Prime Cuirass" + }, + "/lotus/storeitems/upgrades/skins/armor/primesetone/primesetonelegleftarmor": { + "value": "Targis Prime Greaves" + }, + "/lotus/storeitems/upgrades/skins/armor/primesetone/primesetonelegrightarmor": { + "value": "Targis Prime Greaves" + }, + "/lotus/storeitems/upgrades/skins/armor/primesettwo/primesettwoarmleftarmor": { + "value": "Edo Prime Shoulder Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/primesettwo/primesettwoarmrightarmor": { + "value": "Edo Prime Shoulder Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/primesettwo/primesettwochestarmor": { + "value": "Edo Prime Chest Plate" + }, + "/lotus/storeitems/upgrades/skins/armor/primesettwo/primesettwolegleftarmor": { + "value": "Edo Prime Knee Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/primesettwo/primesettwolegrightarmor": { + "value": "Edo Prime Knee Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/setonearmleftarmor": { + "value": "Eos Shoulder Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/setonearmrightarmor": { + "value": "Eos Shoulder Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/setonechestarmor": { + "value": "Eos Chest Plate" + }, + "/lotus/storeitems/upgrades/skins/armor/setonelegleftarmor": { + "value": "Eos Knee Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/setonelegrightarmor": { + "value": "Eos Knee Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/setthreewinged/setthreearmleftarmor": { + "value": "Daedalus Shoulder Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/setthreewinged/setthreearmrightarmor": { + "value": "Daedalus Shoulder Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/setthreewinged/setthreechestarmor": { + "value": "Daedalus Chest Plate" + }, + "/lotus/storeitems/upgrades/skins/armor/setthreewinged/setthreelegleftarmor": { + "value": "Daedalus Knee Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/setthreewinged/setthreelegrightarmor": { + "value": "Daedalus Knee Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/setthreewinged/vtsetthreearmleftarmor": { + "value": "Left Prisma Daedalus Shoulderguard" + }, + "/lotus/storeitems/upgrades/skins/armor/setthreewinged/vtsetthreearmrightarmor": { + "value": "Right Prisma Daedalus Shoulderguard" + }, + "/lotus/storeitems/upgrades/skins/armor/setthreewinged/vtsetthreechestarmor": { + "value": "Prisma Daedalus Chest Plate" + }, + "/lotus/storeitems/upgrades/skins/armor/setthreewinged/vtsetthreelegleftarmor": { + "value": "Left Prisma Daedalus Knee Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/setthreewinged/vtsetthreelegrightarmor": { + "value": "Right Prisma Daedalus Knee Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/settwosamurai/settwoarmleftarmor": { + "value": "Edo Shoulder Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/settwosamurai/settwoarmrightarmor": { + "value": "Edo Shoulder Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/settwosamurai/settwochestarmor": { + "value": "Edo Chest Plate" + }, + "/lotus/storeitems/upgrades/skins/armor/settwosamurai/settwolegleftarmor": { + "value": "Edo Knee Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/settwosamurai/settwolegrightarmor": { + "value": "Edo Knee Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/settwosamurai/vtsettwoarmleftarmor": { + "value": "Left Prisma Edo Shoulder Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/settwosamurai/vtsettwoarmrightarmor": { + "value": "Right Prisma Edo Shoulder Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/settwosamurai/vtsettwochestarmor": { + "value": "Prisma Edo Chest Plate" + }, + "/lotus/storeitems/upgrades/skins/armor/settwosamurai/vtsettwolegleftarmor": { + "value": "Left Prisma Edo Knee Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/settwosamurai/vtsettwolegrightarmor": { + "value": "Right Prisma Edo Knee Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/vteos/vteosalarmor": { + "value": "Left Eos Prime Shoulder Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/vteos/vteosararmor": { + "value": "Right Eos Prime Shoulder Plates" + }, + "/lotus/storeitems/upgrades/skins/armor/vteos/vteoschestarmor": { + "value": "Eos Prime Chest Plate" + }, + "/lotus/storeitems/upgrades/skins/armor/vteos/vteosllarmor": { + "value": "Left Eos Prime Spurs" + }, + "/lotus/storeitems/upgrades/skins/armor/vteos/vteoslrarmor": { + "value": "Right Eos Prime Spurs" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/bansheearmleftarmor": { + "value": "Banshee Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/emberprimearmleftarmor": { + "value": "Ember Prime Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/emberprimearmrightarmor": { + "value": "Ember Prime Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/frostarmleftarmor": { + "value": "Frost Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/frostarmrightarmor": { + "value": "Frost Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/frostprimearmleftarmor": { + "value": "Frost Prime Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/frostprimearmrightarmor": { + "value": "Frost Prime Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/magprimearmleftarmor": { + "value": "Mag Prime Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/magprimearmrightarmor": { + "value": "Mag Prime Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/oberonarmleftarmor": { + "value": "Oberon Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/oberonarmrightarmor": { + "value": "Oberon Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/voltarmleftarmor": { + "value": "Volt Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/voltarmrightarmor": { + "value": "Volt Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/voltprimearmleftarmor": { + "value": "Volt Prime Armor" + }, + "/lotus/storeitems/upgrades/skins/armor/warframedefaults/voltprimearmrightarmor": { + "value": "Volt Prime Armor" + }, + "/lotus/storeitems/upgrades/skins/arrows/alternatearrowa": { + "value": "Cattaril Arrow Skin" + }, + "/lotus/storeitems/upgrades/skins/arrows/alternatearrowb": { + "value": "Sylus Arrow Skin" + }, + "/lotus/storeitems/upgrades/skins/arrows/alternatearrowc": { + "value": "Meer Arrow Skin" + }, + "/lotus/storeitems/upgrades/skins/asp/aspagileanims": { + "value": "Saryn Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/asp/aspalthelmet": { + "value": "Arcane Hemlock Helmet" + }, + "/lotus/storeitems/upgrades/skins/asp/aspalthelmetb": { + "value": "Arcane Chlora Helmet" + }, + "/lotus/storeitems/upgrades/skins/asp/aspalthelmetbstatless": { + "value": "Saryn Chlora Helmet" + }, + "/lotus/storeitems/upgrades/skins/asp/aspalthelmetstatless": { + "value": "Saryn Hemlock Helmet" + }, + "/lotus/storeitems/upgrades/skins/asp/asphelmet": { + "value": "Saryn Helmet" + }, + "/lotus/storeitems/upgrades/skins/asp/aspnobleanims": { + "value": "Saryn Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/asp/sarynalternateskin": { + "value": "Saryn Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/asp/unlockaspagile": { + "value": "Saryn Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/asp/unlockaspnoble": { + "value": "Saryn Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/axe/daggeraxe": { + "value": "Scindo Dagger-axe Skin" + }, + "/lotus/storeitems/upgrades/skins/berserker/berserkeragileanims": { + "value": "Valkyr Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/berserker/berserkerbastethelmet": { + "value": "Valkyr Bastet Helmet" + }, + "/lotus/storeitems/upgrades/skins/berserker/berserkerdangles": { + "value": "Valkyrs Bonds" + }, + "/lotus/storeitems/upgrades/skins/berserker/berserkerhelmet": { + "value": "Valkyr Helmet" + }, + "/lotus/storeitems/upgrades/skins/berserker/berserkernobleanims": { + "value": "Valkyr Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/berserker/unlockberserkeragile": { + "value": "Valkyr Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/berserker/unlockberserkernoble": { + "value": "Valkyr Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/berserker/valkyraltbhelmet": { + "value": "Valkyr Kara Helmet" + }, + "/lotus/storeitems/upgrades/skins/berserker/valkyralternateskin": { + "value": "Valkyr Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/brassandgold/brassandgoldakbolto": { + "value": "Akbolto Ormolu Skin" + }, + "/lotus/storeitems/upgrades/skins/brassandgold/brassandgoldbolto": { + "value": "Bolto Ormolu Skin" + }, + "/lotus/storeitems/upgrades/skins/brassandgold/brassandgolddaikyu": { + "value": "Daikyu Ormolu Skin" + }, + "/lotus/storeitems/upgrades/skins/brassandgold/brassandgoldtipedo": { + "value": "Tipedo Ormolu Skin" + }, + "/lotus/storeitems/upgrades/skins/camo/akimbovipercamo": { + "value": "Desert-camo Twin Vipers" + }, + "/lotus/storeitems/upgrades/skins/camo/gorgoncamo": { + "value": "Desert-camo Gorgon" + }, + "/lotus/storeitems/upgrades/skins/camo/grakatacamo": { + "value": "Desert-camo Grakata" + }, + "/lotus/storeitems/upgrades/skins/camo/grnakimbopistolscamo": { + "value": "Desert-camo Gremlins" + }, + "/lotus/storeitems/upgrades/skins/camo/krackencamo": { + "value": "Desert-camo Kraken" + }, + "/lotus/storeitems/upgrades/skins/camo/sobekcamo": { + "value": "Desert-camo Sobek" + }, + "/lotus/storeitems/upgrades/skins/camo/vipercamo": { + "value": "Desert-camo Viper" + }, + "/lotus/storeitems/upgrades/skins/camo/vulkarcamo": { + "value": "Desert-camo Vulkar" + }, + "/lotus/storeitems/upgrades/skins/catbrows/armor/catbrowarmorhalloweena": { + "value": "Day of the Dead Kavat Armor" + }, + "/lotus/storeitems/upgrades/skins/catbrows/armor/catbrowarmorvoidtradera": { + "value": "Ki'Teer Kavat Armor" + }, + "/lotus/storeitems/upgrades/skins/clan/aggressioneventcorpusbadgeitem": { + "value": "Gradivus: Sacrifice Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/aggressioneventgrineerbadgeitem": { + "value": "Gradivus: Loyalty Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/allianceemblemitem": { + "value": "Alliance Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/baroquantumbadgeitem": { + "value": "Baro KiTeer Sekhara" + }, + "/lotus/storeitems/upgrades/skins/clan/baseeventbadgeitem": { + "value": "Helmet Or Syandana" + }, + "/lotus/storeitems/upgrades/skins/clan/bountyhunterbadgeitem": { + "value": "Stratos Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/clanemblemitem": { + "value": "Clan Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/corpusvoidbadgeitem": { + "value": "Arid Fear Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/excavationevenetbadgeitem": { + "value": "Cryotic Front Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/falseprofiteventbadgeitem": { + "value": "False Profit Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/foundersbadgediscipleitem": { + "value": "Disciples Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/foundersbadgegrandmasteritem": { + "value": "Grand Master Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/foundersbadgehunteritem": { + "value": "Hunters Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/foundersbadgemasteritem": { + "value": "Masters Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/grnsealabeventbadgeitem": { + "value": "Tubemen Of Regor Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/hivesabotageeventbadgeitem": { + "value": "Breeding Grounds Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/infestationeventemblemitem": { + "value": "Emblem Of The Hunt" + }, + "/lotus/storeitems/upgrades/skins/clan/inftacalertdiseasedancientbadgeitem": { + "value": "Brood Mother Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/inftacalertnanitemoaancientbadgeitem": { + "value": "Swarm-mutalist Moa Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/inftacalertpussancientbadgeitem": { + "value": "Boiler Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/inftacalertslowbombmoaancientbadgeitem": { + "value": "Tar-mutalist Moa Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/jungleeventbadgeitem": { + "value": "Cicero Crisis Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/leaderbadgeghostitem": { + "value": "Ghost Leader Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/leaderbadgemoonitem": { + "value": "Moon Leader Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/leaderbadgemountainitem": { + "value": "Mountain Leader Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/leaderbadgeshadowitem": { + "value": "Shadow Leader Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/leaderbadgestormitem": { + "value": "Storm Leader Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/lotusguidebadgeitem": { + "value": "Tenno Mentor Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/mutalistincursionsbadgeitem": { + "value": "Mutalist Incursions Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/nightmaresevantihalobadgeitem": { + "value": "Aseron Sekhara" + }, + "/lotus/storeitems/upgrades/skins/clan/orokinsabotagebadgeitem": { + "value": "Gate Crash Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/referralbadgetieraitem": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/upgrades/skins/clan/referralbadgetierbitem": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/upgrades/skins/clan/referralbadgetiercitem": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/upgrades/skins/clan/referralbadgetierditem": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/upgrades/skins/clan/referralbadgetiereitem": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/upgrades/skins/clan/rescueeventbadgeitem": { + "value": "Specters Of Liberty Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/sevantihalobadgeitem": { + "value": "Sevati Sekhara" + }, + "/lotus/storeitems/upgrades/skins/clan/shipyardseventbadgeitem": { + "value": "Tethras Doom Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/shipyardseventquantumbadgeitem": { + "value": "Tethras Doom Quantum Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/skullbadgebronzeitem": { + "value": "Bronze Skull Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/skullbadgegolditem": { + "value": "Gold Skull Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/skullbadgesilveritem": { + "value": "Silver Skull Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/slingstone2emblemitem": { + "value": "Eyes Of Blight Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/slingstoneemblemitem": { + "value": "Sling Stone Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/survivaleventbadgeitem": { + "value": "Survival Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/translatorbadgeitem": { + "value": "Tenno Operative Emblem" + }, + "/lotus/storeitems/upgrades/skins/clan/wikiabadgeitem": { + "value": "Tenno Chronicler Emblem" + }, + "/lotus/storeitems/upgrades/skins/clothtests/clothtesthelmet": { + "value": "Mesa Helmet" + }, + "/lotus/storeitems/upgrades/skins/clothtests/necrodanglesskelcloth": { + "value": "Mortos Binds" + }, + "/lotus/storeitems/upgrades/skins/contests/longguns/vectissharpshooter": { + "value": "Sharpshooter Vectis" + }, + "/lotus/storeitems/upgrades/skins/contests/longguns/vectissilferer": { + "value": "Silferer Vectis" + }, + "/lotus/storeitems/upgrades/skins/contests/melee/dualzorencombustion": { + "value": "Combustion Dual Zoren" + }, + "/lotus/storeitems/upgrades/skins/contests/melee/dualzorenkuberus": { + "value": "Kuberus Dual Zoren" + }, + "/lotus/storeitems/upgrades/skins/contests/melee/scindocombustion": { + "value": "Combustion Scindo" + }, + "/lotus/storeitems/upgrades/skins/contests/melee/scindokuberus": { + "value": "Kuberus Scindo" + }, + "/lotus/storeitems/upgrades/skins/contests/pistols/akmagnusdakila": { + "value": "Dakila Akmagnus" + }, + "/lotus/storeitems/upgrades/skins/contests/pistols/akmagnushivelight": { + "value": "Hivelight Akmagnus" + }, + "/lotus/storeitems/upgrades/skins/contests/pistols/magnusdakila": { + "value": "Dakila Magnus" + }, + "/lotus/storeitems/upgrades/skins/contests/pistols/magnushivelight": { + "value": "Hivelight Magnus" + }, + "/lotus/storeitems/upgrades/skins/cowgirl/cowgirlagileanims": { + "value": "Mesa Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/cowgirl/cowgirlalthelmet": { + "value": "Mesa Longhorn Helmet" + }, + "/lotus/storeitems/upgrades/skins/cowgirl/cowgirlhelmet": { + "value": "Mesa Helmet" + }, + "/lotus/storeitems/upgrades/skins/cowgirl/cowgirlnobleanims": { + "value": "Mesa Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/cowgirl/mesaaltbhelmet": { + "value": "Mesa Ovis Helmet" + }, + "/lotus/storeitems/upgrades/skins/cowgirl/unlockcowgirlagile": { + "value": "Mesa Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/cowgirl/unlockcowgirlnoble": { + "value": "Mesa Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/dazzle/bratondazzlecamo": { + "value": "Shock Camo Braton" + }, + "/lotus/storeitems/upgrades/skins/dazzle/cestradazzlecamo": { + "value": "Shock Camo Cestra" + }, + "/lotus/storeitems/upgrades/skins/dazzle/deradazzlecamo": { + "value": "Shock Camo Dera" + }, + "/lotus/storeitems/upgrades/skins/dazzle/detrondazzlecamo": { + "value": "Shock Camo Detron" + }, + "/lotus/storeitems/upgrades/skins/dazzle/dualcestradazzlecamo": { + "value": "Shock Camo Dual Cestra" + }, + "/lotus/storeitems/upgrades/skins/dazzle/fluxrifledazzlecamo": { + "value": "Shock Camo Flux Rifle" + }, + "/lotus/storeitems/upgrades/skins/dazzle/lankadazzlecamo": { + "value": "Shock Camo Lanka" + }, + "/lotus/storeitems/upgrades/skins/dazzle/lectadazzlecamo": { + "value": "Shock Camo Lecta" + }, + "/lotus/storeitems/upgrades/skins/dazzle/obexdazzlecamo": { + "value": "Shock Camo Obex" + }, + "/lotus/storeitems/upgrades/skins/dazzle/pentadazzlecamo": { + "value": "Shock Camo Penta" + }, + "/lotus/storeitems/upgrades/skins/dazzle/provadazzlecamo": { + "value": "Shock Camo Prova" + }, + "/lotus/storeitems/upgrades/skins/dazzle/snipetrondazzlecamo": { + "value": "Shock Camo Snipetron" + }, + "/lotus/storeitems/upgrades/skins/dazzle/spectradazzlecamo": { + "value": "Shock Camo Spectra" + }, + "/lotus/storeitems/upgrades/skins/dazzle/supradazzlecamo": { + "value": "Shock Camo Supra" + }, + "/lotus/storeitems/upgrades/skins/dazzle/tetradazzlecamo": { + "value": "Shock Camo Tetra" + }, + "/lotus/storeitems/upgrades/skins/decree/bansheealternateskin": { + "value": "Banshee Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/decree/decreeagileanims": { + "value": "Banshee Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/decree/decreealthelmet": { + "value": "Arcane Reverb Helmet" + }, + "/lotus/storeitems/upgrades/skins/decree/decreealthelmetb": { + "value": "Arcane Chorus Helmet" + }, + "/lotus/storeitems/upgrades/skins/decree/decreealthelmetbstatless": { + "value": "Banshee Chorus Helmet" + }, + "/lotus/storeitems/upgrades/skins/decree/decreealthelmetstatless": { + "value": "Banshee Reverb Helmet" + }, + "/lotus/storeitems/upgrades/skins/decree/decreehelmet": { + "value": "Banshee Helmet" + }, + "/lotus/storeitems/upgrades/skins/decree/decreenobleanims": { + "value": "Banshee Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/decree/unlockdecreeagile": { + "value": "Banshee Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/decree/unlockdecreenoble": { + "value": "Banshee Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/dragon/chromaagileanims": { + "value": "Chroma Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/dragon/chromaaltbhelmet": { + "value": "Chroma Amaru Helmet" + }, + "/lotus/storeitems/upgrades/skins/dragon/chromanobleanims": { + "value": "Chroma Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/dragon/dragonalthelmet": { + "value": "Chroma Drac Helmet" + }, + "/lotus/storeitems/upgrades/skins/dragon/dragonhelmet": { + "value": "Chroma Helmet" + }, + "/lotus/storeitems/upgrades/skins/dragon/unlockchromaagile": { + "value": "Chroma Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/dragon/unlockchromanoble": { + "value": "Chroma Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/dualaxe/daggeraxe": { + "value": "Dual Zoren Dagger-axe Skin" + }, + "/lotus/storeitems/upgrades/skins/ember/emberagileanims": { + "value": "Ember Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/ember/emberalternateskin": { + "value": "Ember Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/ember/emberhelmet": { + "value": "Ember Helmet" + }, + "/lotus/storeitems/upgrades/skins/ember/emberhelmetalt": { + "value": "Arcane Phoenix Helmet" + }, + "/lotus/storeitems/upgrades/skins/ember/emberhelmetaltb": { + "value": "Arcane Backdraft Helmet" + }, + "/lotus/storeitems/upgrades/skins/ember/emberhelmetaltbstatless": { + "value": "Ember Backdraft Helmet" + }, + "/lotus/storeitems/upgrades/skins/ember/emberhelmetaltstatless": { + "value": "Ember Phoenix Helmet" + }, + "/lotus/storeitems/upgrades/skins/ember/embernobleanims": { + "value": "Ember Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/ember/emberprimehelmet": { + "value": "Ember Prime Helmet" + }, + "/lotus/storeitems/upgrades/skins/ember/unlockemberagile": { + "value": "Ember Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/ember/unlockembernoble": { + "value": "Ember Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/events/archrocketcrossbowgrineer": { + "value": "Fluctus Rahk Skin" + }, + "/lotus/storeitems/upgrades/skins/events/blackoutorthos": { + "value": "Orthos Phased Skin" + }, + "/lotus/storeitems/upgrades/skins/events/bunnyears": { + "value": "Lepus Headgear" + }, + "/lotus/storeitems/upgrades/skins/events/glaxionpolar": { + "value": "Glaxion Polar Skin" + }, + "/lotus/storeitems/upgrades/skins/events/infquantainfestedaladv": { + "value": "Paracyst Zebra Skin" + }, + "/lotus/storeitems/upgrades/skins/excalibur/excaliburagileanims": { + "value": "Excalibur Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/excalibur/excaliburalternateskin": { + "value": "Excalibur Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/excalibur/excaliburhelmet": { + "value": "Excalibur Helmet" + }, + "/lotus/storeitems/upgrades/skins/excalibur/excaliburhelmetalt": { + "value": "Arcane Avalon Helmet" + }, + "/lotus/storeitems/upgrades/skins/excalibur/excaliburhelmetaltb": { + "value": "Arcane Pendragon Helmet" + }, + "/lotus/storeitems/upgrades/skins/excalibur/excaliburhelmetaltbstatless": { + "value": "Excalibur Pendragon Helmet" + }, + "/lotus/storeitems/upgrades/skins/excalibur/excaliburhelmetaltstatless": { + "value": "Excalibur Avalon Helmet" + }, + "/lotus/storeitems/upgrades/skins/excalibur/excaliburhelmetmordred": { + "value": "Excalibur Mordred Helmet" + }, + "/lotus/storeitems/upgrades/skins/excalibur/excaliburnobleanims": { + "value": "Excalibur Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/excalibur/excaliburprimealabasterskin": { + "value": "Alabaster Skin" + }, + "/lotus/storeitems/upgrades/skins/excalibur/excaliburprimealternateskin": { + "value": "Excalibur Prime Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/excalibur/excaliburprimehelmet": { + "value": "Excalibur Prime Helmet" + }, + "/lotus/storeitems/upgrades/skins/excalibur/excaliburprotohelmet": { + "value": "Excalibur Proto-armor Helmet" + }, + "/lotus/storeitems/upgrades/skins/excalibur/excaliburprotosuit": { + "value": "Excalibur Proto-armor Skin" + }, + "/lotus/storeitems/upgrades/skins/excalibur/geoffcaliburhelmet": { + "value": "Excalibur Helmet" + }, + "/lotus/storeitems/upgrades/skins/excalibur/unlockexcaliburagile": { + "value": "Excalibur Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/excalibur/unlockexcaliburnoble": { + "value": "Excalibur Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/festivities/xmasglaxion": { + "value": "Glaxion Festive Skin" + }, + "/lotus/storeitems/upgrades/skins/frost/frostagileanims": { + "value": "Frost Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/frost/frostalternateskin": { + "value": "Frost Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/frost/frosthelmet": { + "value": "Frost Helmet" + }, + "/lotus/storeitems/upgrades/skins/frost/frosthelmetalt": { + "value": "Arcane Aurora Helmet" + }, + "/lotus/storeitems/upgrades/skins/frost/frosthelmetaltb": { + "value": "Arcane Squall Helmet" + }, + "/lotus/storeitems/upgrades/skins/frost/frosthelmetaltbstatless": { + "value": "Frost Squall Helmet" + }, + "/lotus/storeitems/upgrades/skins/frost/frosthelmetaltstatless": { + "value": "Frost Aurora Helmet" + }, + "/lotus/storeitems/upgrades/skins/frost/frostnobleanims": { + "value": "Frost Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/frost/frostprimealternateskin": { + "value": "Frost Prime Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/frost/frostprimehelmet": { + "value": "Frost Prime Helmet" + }, + "/lotus/storeitems/upgrades/skins/frost/frostxmasskin": { + "value": "Frost Festive Skin" + }, + "/lotus/storeitems/upgrades/skins/frost/unlockfrostagile": { + "value": "Frost Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/frost/unlockfrostnoble": { + "value": "Frost Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestafuris": { + "value": "Forest-camo Afuris" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestballistica": { + "value": "Forest-camo Ballistica" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestboltor": { + "value": "Forest-camo Boltor" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestbraton": { + "value": "Forest-camo Braton" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestdethcube": { + "value": "Forest-camo Dethcube" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestdualheatswords": { + "value": "Forest-camo Dual Heat Swords" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestdualvastos": { + "value": "Forest-camo Akvasto" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestdualzoren": { + "value": "Forest-camo Dual Zoren" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestfuris": { + "value": "Forest-camo Furis" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestheatdagger": { + "value": "Forest-camo Heat Dagger" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestheatsword": { + "value": "Forest-camo Heat Sword" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestorthos": { + "value": "Forest-camo Orthos" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestparis": { + "value": "Forest-camo Paris" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestscindo": { + "value": "Forest-camo Scindo" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestsoma": { + "value": "Forest-camo Soma" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestvasto": { + "value": "Forest-camo Vasto" + }, + "/lotus/storeitems/upgrades/skins/grineerforest/grineerforestvectis": { + "value": "Forest-camo Vectis" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenaklato": { + "value": "Aklato Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenakvasto": { + "value": "Akvasto Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenamprex": { + "value": "Amprex Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenbraton": { + "value": "Braton Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenbuzlok": { + "value": "Buzlok Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweendualzoren": { + "value": "Zoren Day Of The Dead Dual Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenglaive": { + "value": "Glaive Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenglaxion": { + "value": "Glaxion Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweengorgon": { + "value": "Gorgon Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweengrinlok": { + "value": "Grinlok Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenjatkittag": { + "value": "Kittag Day Of The Dead Jat Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenkronen": { + "value": "Kronen Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenlato": { + "value": "Lato Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenlatovandal": { + "value": "Lato Vandal Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenmarelok": { + "value": "Marelok Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweennukor": { + "value": "Nukor Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenorthos": { + "value": "Orthos Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenparis": { + "value": "Paris Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenscindo": { + "value": "Scindo Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweensobek": { + "value": "Sobek Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweensoma": { + "value": "Soma Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweentwingremlins": { + "value": "Gremlins Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halloween/halloweenvasto": { + "value": "Vasto Day Of The Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/halos/prototyperaidhalo": { + "value": "Sevati Sekhara" + }, + "/lotus/storeitems/upgrades/skins/hammer/grnhammer": { + "value": "Fragor Brokk Skin" + }, + "/lotus/storeitems/upgrades/skins/harlequin/harlequinagileanims": { + "value": "Mirage Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/harlequin/harlequinhelmet": { + "value": "Mirage Helmet" + }, + "/lotus/storeitems/upgrades/skins/harlequin/harlequinhelmetalt": { + "value": "Mirage Harlequin Helmet" + }, + "/lotus/storeitems/upgrades/skins/harlequin/harlequinnobleanims": { + "value": "Mirage Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/harlequin/miragealtbhelmet": { + "value": "Mirage Trivelin Helmet" + }, + "/lotus/storeitems/upgrades/skins/harlequin/miragexmasskin": { + "value": "Mirage Winter Skin" + }, + "/lotus/storeitems/upgrades/skins/harlequin/unlockharlequinagile": { + "value": "Mirage Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/harlequin/unlockharlequinnoble": { + "value": "Mirage Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/heavyaxe/grnaxe": { + "value": "Scindo Manticore Skin" + }, + "/lotus/storeitems/upgrades/skins/hydroid/hydroidagileanims": { + "value": "Hydroid Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/hydroid/hydroidnobleanims": { + "value": "Hydroid Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/hydroid/unlockhydroidagile": { + "value": "Hydroid Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/hydroid/unlockhydroidnoble": { + "value": "Hydroid Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/iahgames/iahgamesbratonskin": { + "value": "Iahgames Braton" + }, + "/lotus/storeitems/upgrades/skins/jade/jadeagileanims": { + "value": "Nyx Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/jade/jadehelmet": { + "value": "Nyx Helmet" + }, + "/lotus/storeitems/upgrades/skins/jade/jadehelmetalt": { + "value": "Arcane Menticide Helmet" + }, + "/lotus/storeitems/upgrades/skins/jade/jadehelmetaltb": { + "value": "Arcane Vespa Helmet" + }, + "/lotus/storeitems/upgrades/skins/jade/jadehelmetaltbstatless": { + "value": "Nyx Vespa Helmet" + }, + "/lotus/storeitems/upgrades/skins/jade/jadehelmetaltstatless": { + "value": "Nyx Menticide Helmet" + }, + "/lotus/storeitems/upgrades/skins/jade/jadenobleanims": { + "value": "Nyx Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/jade/nyxalternateskin": { + "value": "Nyx Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/jade/nyxnemesishelmet": { + "value": "Nyx Nemesis Helmet" + }, + "/lotus/storeitems/upgrades/skins/jade/nyxnemesissuit": { + "value": "Nyx Nemesis Skin" + }, + "/lotus/storeitems/upgrades/skins/jade/nyxprimehelmet": { + "value": "Nyx Prime Helmet" + }, + "/lotus/storeitems/upgrades/skins/jade/unlockjadeagile": { + "value": "Nyx Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/jade/unlockjadenoble": { + "value": "Nyx Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/katanasheaths/dragonkatanasheathlightning": { + "value": "Surt-form Gemini Nikana Sheath" + }, + "/lotus/storeitems/upgrades/skins/katanasheaths/katanasheathbasic": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/upgrades/skins/katanasheaths/katanasheathlightning": { + "value": "Ymir-form Gemini Nikana Sheath" + }, + "/lotus/storeitems/upgrades/skins/kubrows/armor/kubrowarmorbaro": { + "value": "Ki'Teer Kubrow Armor" + }, + "/lotus/storeitems/upgrades/skins/liset/gyroscope/lisetgyroscopeskinprimetrader": { + "value": "Xiphos Prisma Skin" + }, + "/lotus/storeitems/upgrades/skins/liset/lisetblueskyskinprimetrader": { + "value": "Scimitar Prisma Skin" + }, + "/lotus/storeitems/upgrades/skins/liset/lisetinsectskinprimetrader": { + "value": "Mantis Prisma Skin" + }, + "/lotus/storeitems/upgrades/skins/liset/lisetskinflavouritemb": { + "value": "Liset Hima Skin" + }, + "/lotus/storeitems/upgrades/skins/liset/lisetskinflavouritemc": { + "value": "Liset Kuza Skin" + }, + "/lotus/storeitems/upgrades/skins/liset/lisetskinflavouritemd": { + "value": "Liset Zikha Skin" + }, + "/lotus/storeitems/upgrades/skins/liset/lisetskinkaboom": { + "value": "Liset Pahta Skin" + }, + "/lotus/storeitems/upgrades/skins/liset/lisetskinkotora": { + "value": "Liset Kotara Skin" + }, + "/lotus/storeitems/upgrades/skins/liset/lisetskinvoidtrader": { + "value": "Liset Prisma Skin" + }, + "/lotus/storeitems/upgrades/skins/loki/lokiagileanims": { + "value": "Loki Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/loki/lokialternateskin": { + "value": "Loki Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/loki/lokienigmahelmet": { + "value": "Loki Enigma Helmet" + }, + "/lotus/storeitems/upgrades/skins/loki/lokihelmet": { + "value": "Loki Helmet" + }, + "/lotus/storeitems/upgrades/skins/loki/lokihelmetalt": { + "value": "Arcane Essence Helmet" + }, + "/lotus/storeitems/upgrades/skins/loki/lokihelmetaltb": { + "value": "Arcane Swindle Helmet" + }, + "/lotus/storeitems/upgrades/skins/loki/lokihelmetaltbstatless": { + "value": "Loki Swindle Helmet" + }, + "/lotus/storeitems/upgrades/skins/loki/lokihelmetaltstatless": { + "value": "Loki Essence Helmet" + }, + "/lotus/storeitems/upgrades/skins/loki/lokinobleanims": { + "value": "Loki Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/loki/lokiprimehelmet": { + "value": "Loki Prime Helmet" + }, + "/lotus/storeitems/upgrades/skins/loki/unlocklokiagile": { + "value": "Loki Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/loki/unlocklokinoble": { + "value": "Loki Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/mag/magagileanims": { + "value": "Mag Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/mag/magalternateskin": { + "value": "Mag Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/mag/maghelmet": { + "value": "Mag Helmet" + }, + "/lotus/storeitems/upgrades/skins/mag/maghelmetalt": { + "value": "Arcane Coil Helmet" + }, + "/lotus/storeitems/upgrades/skins/mag/maghelmetaltb": { + "value": "Arcane Gauss Helmet" + }, + "/lotus/storeitems/upgrades/skins/mag/maghelmetaltbstatless": { + "value": "Mag Gauss Helmet" + }, + "/lotus/storeitems/upgrades/skins/mag/maghelmetaltstatless": { + "value": "Mag Coil Helmet" + }, + "/lotus/storeitems/upgrades/skins/mag/magnobleanims": { + "value": "Mag Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/mag/magprimehelmet": { + "value": "Mag Prime Helmet" + }, + "/lotus/storeitems/upgrades/skins/mag/unlockmagagile": { + "value": "Mag Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/mag/unlockmagnoble": { + "value": "Mag Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/magician/magicianagileanims": { + "value": "Limbo Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/magician/magicianaltbhelmet": { + "value": "Limbo Magrite Helmet" + }, + "/lotus/storeitems/upgrades/skins/magician/magicianaristeashelmet": { + "value": "Limbo Aristeas Helmet" + }, + "/lotus/storeitems/upgrades/skins/magician/magicianhelmet": { + "value": "Limbo Helmet" + }, + "/lotus/storeitems/upgrades/skins/magician/magiciannobleanims": { + "value": "Limbo Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/magician/unlockmagicianagile": { + "value": "Limbo Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/magician/unlockmagiciannoble": { + "value": "Limbo Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/meleedangles/baroinarosmeleedangle": { + "value": "Anpu Sugatra" + }, + "/lotus/storeitems/upgrades/skins/meleedangles/baromeleedangle": { + "value": "Ki'Teer Sugatra" + }, + "/lotus/storeitems/upgrades/skins/meleedangles/chaintridentmeleedangle": { + "value": "Pazza Sugatra" + }, + "/lotus/storeitems/upgrades/skins/meleedangles/cordsmeleedangle": { + "value": "Tantu Sugatra" + }, + "/lotus/storeitems/upgrades/skins/meleedangles/firemeleedangle": { + "value": "Pyra Sugatra" + }, + "/lotus/storeitems/upgrades/skins/meleedangles/grnmeleedangle": { + "value": "Caggro Sugatra" + }, + "/lotus/storeitems/upgrades/skins/meleedangles/kazeruprimemeleedangle": { + "value": "Kazeru Prime Sugatra" + }, + "/lotus/storeitems/upgrades/skins/meleedangles/lotuspointmeleedangle": { + "value": "Suraka Sugatra" + }, + "/lotus/storeitems/upgrades/skins/meleedangles/polearmfriendlymeleedangle": { + "value": "Daman Sugatra" + }, + "/lotus/storeitems/upgrades/skins/meleedangles/primemeleedangle": { + "value": "Daman Sugatra Prime" + }, + "/lotus/storeitems/upgrades/skins/meleedangles/razormeleedangle": { + "value": "Uru Sugatra" + }, + "/lotus/storeitems/upgrades/skins/meleedangles/tennomeleedangle": { + "value": "Pataga Sugatra" + }, + "/lotus/storeitems/upgrades/skins/meleedangles/valaprimemeleedangle": { + "value": "Vala Sugatra Prime" + }, + "/lotus/storeitems/upgrades/skins/miscellaneous/huntsmansoma": { + "value": "Soma Huntsman Skin" + }, + "/lotus/storeitems/upgrades/skins/mustache/stache": { + "value": "The Gentleman" + }, + "/lotus/storeitems/upgrades/skins/mustache/stache02": { + "value": "The Tusker" + }, + "/lotus/storeitems/upgrades/skins/mustache/stache03": { + "value": "The Magnum" + }, + "/lotus/storeitems/upgrades/skins/mustache/stache04": { + "value": "The Villain" + }, + "/lotus/storeitems/upgrades/skins/mustache/stache05": { + "value": "The Baron" + }, + "/lotus/storeitems/upgrades/skins/necro/necroagileanims": { + "value": "Nekros Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/necro/necroaraknidhelmet": { + "value": "Nekros Raknis Helmet" + }, + "/lotus/storeitems/upgrades/skins/necro/necrodangles": { + "value": "Mortos Binds" + }, + "/lotus/storeitems/upgrades/skins/necro/necrohelmet": { + "value": "Nekros Helmet" + }, + "/lotus/storeitems/upgrades/skins/necro/necronobleanims": { + "value": "Nekros Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/necro/necroshroudhelmet": { + "value": "Nekros Shroud Helmet" + }, + "/lotus/storeitems/upgrades/skins/necro/nekrosalternateskin": { + "value": "Nekros Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/necro/unlocknecroagile": { + "value": "Nekros Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/necro/unlocknecronoble": { + "value": "Nekros Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/ninja/ashalternateskin": { + "value": "Ash Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/ninja/ashprimehelmet": { + "value": "Ash Prime Helmet" + }, + "/lotus/storeitems/upgrades/skins/ninja/ninjaagileanims": { + "value": "Ash Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/ninja/ninjahelmet": { + "value": "Ash Helmet" + }, + "/lotus/storeitems/upgrades/skins/ninja/ninjahelmetalt": { + "value": "Arcane Scorpion Helmet" + }, + "/lotus/storeitems/upgrades/skins/ninja/ninjahelmetaltb": { + "value": "Arcane Locust Helmet" + }, + "/lotus/storeitems/upgrades/skins/ninja/ninjahelmetaltbstatless": { + "value": "Ash Locust Helmet" + }, + "/lotus/storeitems/upgrades/skins/ninja/ninjahelmetaltstatless": { + "value": "Ash Scorpion Helmet" + }, + "/lotus/storeitems/upgrades/skins/ninja/ninjanobleanims": { + "value": "Ash Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/ninja/unlockninjaagile": { + "value": "Ash Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/ninja/unlockninjanoble": { + "value": "Ash Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/nvidia/nvidiabratonskin": { + "value": "Nvidia Braton" + }, + "/lotus/storeitems/upgrades/skins/operator/accessories/baromouthpiecea": { + "value": "Ki'Teer Atmos Mask" + }, + "/lotus/storeitems/upgrades/skins/operator/accessories/barotiara": { + "value": "Ki'Teer Atmos Diadem" + }, + "/lotus/storeitems/upgrades/skins/operator/accessories/earpiecebaroa": { + "value": "Ki'Teer Earpiece" + }, + "/lotus/storeitems/upgrades/skins/operator/accessories/earpiecebarob": { + "value": "Ki'Teer Solo Earpiece" + }, + "/lotus/storeitems/upgrades/skins/operator/accessories/earpiecebaroc": { + "value": "Ki'Teer Atmos Earpiece" + }, + "/lotus/storeitems/upgrades/skins/paladin/oberonalternateskin": { + "value": "Oberon Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/paladin/paladinagileanims": { + "value": "Oberon Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/paladin/paladinhelmet": { + "value": "Oberon Helmet" + }, + "/lotus/storeitems/upgrades/skins/paladin/paladinhelmetalt": { + "value": "Oberon Oryx Helmet" + }, + "/lotus/storeitems/upgrades/skins/paladin/paladinhelmetaltb": { + "value": "Oberon Markhor Helmet" + }, + "/lotus/storeitems/upgrades/skins/paladin/paladinnobleanims": { + "value": "Oberon Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/paladin/unlockpaladinagile": { + "value": "Oberon Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/paladin/unlockpaladinnoble": { + "value": "Oberon Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/pirate/hydroidalternateskin": { + "value": "Hydroid Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/pirate/piratealtbhelmet": { + "value": "Hydroid Ketos Helmet" + }, + "/lotus/storeitems/upgrades/skins/pirate/piratealthelmet": { + "value": "Hydroid Triton Helmet" + }, + "/lotus/storeitems/upgrades/skins/pirate/piratedefaulthelmet": { + "value": "Hydroid Helmet" + }, + "/lotus/storeitems/upgrades/skins/promo/microsoft/excaliburxboneskin": { + "value": "Emerald Excalibur" + }, + "/lotus/storeitems/upgrades/skins/promo/microsoft/excaliburxboneskinhelmet": { + "value": "Excalibur Jade" + }, + "/lotus/storeitems/upgrades/skins/promo/microsoft/jadedualkamas": { + "value": "Kama Jade Skin" + }, + "/lotus/storeitems/upgrades/skins/promo/microsoft/jadekama": { + "value": "Kama Jade Skin" + }, + "/lotus/storeitems/upgrades/skins/promo/microsoft/jadelatron": { + "value": "Latron Jade Skin" + }, + "/lotus/storeitems/upgrades/skins/promo/rixtymol/rixtymolaklatoskin": { + "value": "Rixtymol Aklato" + }, + "/lotus/storeitems/upgrades/skins/promo/seasonal/candycaneetherreaperskin": { + "value": "Spearmint Scythe" + }, + "/lotus/storeitems/upgrades/skins/promo/seasonal/candycanehateskin": { + "value": "Spearmint Scythe" + }, + "/lotus/storeitems/upgrades/skins/promo/seasonal/candycanereaperprimeskin": { + "value": "Spearmint Scythe" + }, + "/lotus/storeitems/upgrades/skins/promo/void/akvastosvoidskin": { + "value": "Akvasto Phased Skin" + }, + "/lotus/storeitems/upgrades/skins/promo/void/ankyrosvoidskin": { + "value": "Ankyros Phased Skin" + }, + "/lotus/storeitems/upgrades/skins/promo/void/tigrisvoidskin": { + "value": "Tigris Phased Skin" + }, + "/lotus/storeitems/upgrades/skins/promo/void/vastovoidskin": { + "value": "Vasto Phased Skin" + }, + "/lotus/storeitems/upgrades/skins/promo/warframe/promoparis": { + "value": "Paris Abra Skin" + }, + "/lotus/storeitems/upgrades/skins/promo/warframe/protoglaive": { + "value": "Proto-glaive Skin" + }, + "/lotus/storeitems/upgrades/skins/referralseriestwo/rubedoakimbovipercamo": { + "value": "Twin Vipers Rubedo Plated Skin" + }, + "/lotus/storeitems/upgrades/skins/referralseriestwo/rubedodrakgooncamo": { + "value": "Drakgoon Rubedo Plated Skin" + }, + "/lotus/storeitems/upgrades/skins/referralseriestwo/rubedogalatinecamo": { + "value": "Galatine Rubedo Plated Skin" + }, + "/lotus/storeitems/upgrades/skins/referralseriestwo/rubedovipercamo": { + "value": "Viper Rubedo Plated Skin" + }, + "/lotus/storeitems/upgrades/skins/rhino/rhinoagileanims": { + "value": "Rhino Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/rhino/rhinoalternateskin": { + "value": "Rhino Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/rhino/rhinohelmet": { + "value": "Rhino Helmet" + }, + "/lotus/storeitems/upgrades/skins/rhino/rhinohelmetalt": { + "value": "Arcane Thrak Helmet" + }, + "/lotus/storeitems/upgrades/skins/rhino/rhinohelmetaltb": { + "value": "Arcane Vanguard Helmet" + }, + "/lotus/storeitems/upgrades/skins/rhino/rhinohelmetaltbstatless": { + "value": "Rhino Vanguard Helmet" + }, + "/lotus/storeitems/upgrades/skins/rhino/rhinohelmetaltstatless": { + "value": "Rhino Thrak Helmet" + }, + "/lotus/storeitems/upgrades/skins/rhino/rhinonobleanims": { + "value": "Rhino Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/rhino/rhinoprimehelmet": { + "value": "Rhino Prime Helmet" + }, + "/lotus/storeitems/upgrades/skins/rhino/rhinorubedoskin": { + "value": "Rhino Rubedo Plated Skin" + }, + "/lotus/storeitems/upgrades/skins/rhino/rhinorubedoskinhelmet": { + "value": "Rubedo Plated Helmet" + }, + "/lotus/storeitems/upgrades/skins/rhino/unlockrhinoagile": { + "value": "Rhino Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/rhino/unlockrhinonoble": { + "value": "Rhino Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/scarves/april2015scarf": { + "value": "Kyroptera Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/armscarf": { + "value": "Yomo Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/barocape": { + "value": "Ki'Teer Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/barocape2scarf": { + "value": "Ki'Teer Razza Synadana" + }, + "/lotus/storeitems/upgrades/skins/scarves/brassandgoldscarf": { + "value": "Ormolu Kyroptera Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/dinospikescarf": { + "value": "Yamako Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/energyscarf": { + "value": "Asa Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/energyscarfvoidskin": { + "value": "Phased Asa Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/flamescarf": { + "value": "Pyra Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/grineerturbinesscarf": { + "value": "Harkonar Cloak" + }, + "/lotus/storeitems/upgrades/skins/scarves/holidayturtleneckscarf": { + "value": "Festive Imperator Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/hornskullscarf": { + "value": "Rakta Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/hornskullscarfdefault": { + "value": "Hecate Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/infestedfinsscarf": { + "value": "Iliac Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/kazbarocape": { + "value": "Ki'Teer Diax Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/lisetscarf": { + "value": "Domus Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/noruprimescarf": { + "value": "Noru Prime Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/primeflamescarf": { + "value": "Pyra Prime Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/primescarf": { + "value": "Misa Prime Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/ps4armscarf": { + "value": "Yomo Obsidian Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/razorscarf": { + "value": "Uru Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/rubedodinospikescarf": { + "value": "Rubedo Plated Yamako Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/solsticebarocape": { + "value": "Solstice Ki'Teer Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/syndicateahscarf": { + "value": "Telos Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/syndicatecsscarf": { + "value": "Synoid Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/syndicatenlscarf": { + "value": "Sancti Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/syndicatepsscarf": { + "value": "Secura Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/syndicatervscarf": { + "value": "Asita Rakta Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/syndicatesmscarf": { + "value": "Vaykor Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/turtleneckscarf": { + "value": "Imperator Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/vtdinospikescarf": { + "value": "Prisma Yamako Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/vthornskullscarf": { + "value": "Prisma Hecate Syandana" + }, + "/lotus/storeitems/upgrades/skins/scarves/yamakoprimescarf": { + "value": "Yamako Prime Syandana" + }, + "/lotus/storeitems/upgrades/skins/sentinels/carbuncledethcubeskin": { + "value": "Carabus Dethcube" + }, + "/lotus/storeitems/upgrades/skins/sentinels/masks/baropetmask": { + "value": "Ki'Teer Sentinel Mask" + }, + "/lotus/storeitems/upgrades/skins/sentinels/masks/gunheadmask": { + "value": "Coltek Sentinel Mask" + }, + "/lotus/storeitems/upgrades/skins/sentinels/masks/hunhowmask": { + "value": "Hunhow Sentinel Mask" + }, + "/lotus/storeitems/upgrades/skins/sentinels/masks/ictusmask": { + "value": "Ictus Sentinel Mask" + }, + "/lotus/storeitems/upgrades/skins/sentinels/masks/infestedmask": { + "value": "Mandible Mask" + }, + "/lotus/storeitems/upgrades/skins/sentinels/masks/kubrowmask": { + "value": "Kubrow Sentinel Mask" + }, + "/lotus/storeitems/upgrades/skins/sentinels/masks/lotusmask": { + "value": "Lotus Sentinel Mask" + }, + "/lotus/storeitems/upgrades/skins/sentinels/masks/mechheadmask": { + "value": "Mech Head Sentinel Mask" + }, + "/lotus/storeitems/upgrades/skins/sentinels/masks/orokinmask": { + "value": "Summus Prime Sentinel Mask" + }, + "/lotus/storeitems/upgrades/skins/sentinels/masks/parrotmask": { + "value": "Para Sentinel Mask" + }, + "/lotus/storeitems/upgrades/skins/sentinels/masks/primesentinelmask": { + "value": "Unda Prime Sentinel Mask" + }, + "/lotus/storeitems/upgrades/skins/sentinels/masks/prismamechheadmask": { + "value": "Prisma Mech Head Sentinel Mask" + }, + "/lotus/storeitems/upgrades/skins/sentinels/parrotcarrierskin": { + "value": "Para Carrier" + }, + "/lotus/storeitems/upgrades/skins/sentinels/skins/librarianhelios": { + "value": "Helios Simaris Skin" + }, + "/lotus/storeitems/upgrades/skins/sentinels/spriteshadeskin": { + "value": "Sprite Shade" + }, + "/lotus/storeitems/upgrades/skins/sentinels/tails/baropettail": { + "value": "Ki'Teer Sentinel Tail" + }, + "/lotus/storeitems/upgrades/skins/sentinels/tails/capsuletail": { + "value": "Capsule Sentinel Tail" + }, + "/lotus/storeitems/upgrades/skins/sentinels/tails/coltektail": { + "value": "Coltek Sentinel Tail" + }, + "/lotus/storeitems/upgrades/skins/sentinels/tails/fishtail": { + "value": "Koi Sentinel Tail" + }, + "/lotus/storeitems/upgrades/skins/sentinels/tails/ictustail": { + "value": "Ictus Sentinel Tail" + }, + "/lotus/storeitems/upgrades/skins/sentinels/tails/infestedtail": { + "value": "Thorax Tail" + }, + "/lotus/storeitems/upgrades/skins/sentinels/tails/kavatpettail": { + "value": "Kavat Sentinel Tail" + }, + "/lotus/storeitems/upgrades/skins/sentinels/tails/orokintail": { + "value": "Summus Prime Sentinel Tail" + }, + "/lotus/storeitems/upgrades/skins/sentinels/tails/parrottail": { + "value": "Para Sentinel Tail" + }, + "/lotus/storeitems/upgrades/skins/sentinels/tails/primesentineltail": { + "value": "Unda Prime Sentinel Tail" + }, + "/lotus/storeitems/upgrades/skins/sentinels/tails/prismafishtail": { + "value": "Prisma Koi Sentinel Tail" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/baropetwings": { + "value": "Ki'Teer Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/coltekwings": { + "value": "Coltek Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/coltekwingsright": { + "value": "Coltek Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/diamondwings": { + "value": "Diamond Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/diamondwingsright": { + "value": "Diamond Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/domewings": { + "value": "Dome Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/domewingsright": { + "value": "Dome Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/ictuswings": { + "value": "Ictus Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/ictuswingsright": { + "value": "Ictus Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/infestedwings": { + "value": "Chrysalis Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/infestedwingsright": { + "value": "Chrysalis Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/jetwings": { + "value": "Jet Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/jetwingsright": { + "value": "Jet Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/orokinwings": { + "value": "Summus Prime Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/orokinwingsright": { + "value": "Summus Prime Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/parrotwings": { + "value": "Para Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/parrotwingsright": { + "value": "Para Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/primesentinelwings": { + "value": "Unda Prime Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/primesentinelwingsright": { + "value": "Unda Prime Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sentinels/wings/prismajetwings": { + "value": "Prisma Jet Sentinel Wings" + }, + "/lotus/storeitems/upgrades/skins/sigils/alliancesigilbasic": { + "value": "Alliance Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bladeandgunsigil": { + "value": "Blade And Gun Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bosssigilaladv": { + "value": "Alad V Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bosssigilambulas": { + "value": "Ambulas Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bosssigilcaptainvor": { + "value": "Vor Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bosssigilhyenapack": { + "value": "Hyena Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bosssigiljackal": { + "value": "Jackal Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bosssigillechkril": { + "value": "Lech Kril Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bosssigillephantis": { + "value": "Lephantis Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bosssigillynx": { + "value": "Lynx Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bosssigilnefanyo": { + "value": "Nef Anyo Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bosssigilphorid": { + "value": "Phorid Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bosssigilraptor": { + "value": "Raptor Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bosssigilsargusruk": { + "value": "Sargas Ruk Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bosssigiltylregor": { + "value": "Tyl Regor Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/bosssigilvayhek": { + "value": "Vay Hek Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/clansigilbasic": { + "value": "Clan Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/clansigilbasicadd": { + "value": "Phased Clan Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/clansigilmaskedeffect": { + "value": "Gilded Clan Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/clansigiltwotone": { + "value": "Glyphed Clan Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/collectorsigil": { + "value": "Cephalon Simaris Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/deathmarksigilgrustrag": { + "value": "Grustrag Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/deathmarksigilstalker": { + "value": "Stalker Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/deathmarksigilzanuka": { + "value": "Zanuka Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/dotd2016sigil": { + "value": "Day of the Dead (2016) Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/energysigila": { + "value": "Rift Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/eventsigilfalseprofit": { + "value": "False Profit Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/eventsigilindex": { + "value": "Index Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/firesigil": { + "value": "Flaming Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/foundersigildisciple": { + "value": "Disciple Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/foundersigilgrandmaster": { + "value": "Grand Master Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/foundersigilhunter": { + "value": "Hunter Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/foundersigilmaster": { + "value": "Master Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/holidaysigilsnowflake": { + "value": "Festive Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/holidaysigilxmas2014a": { + "value": "Wreath Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/holidaysigilxmas2014b": { + "value": "Nistlebrush Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/holidaysigilxmas2014c": { + "value": "Tolling Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/holidaysigilxmas2014d": { + "value": "Evergreen Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/lotusguidesigil": { + "value": "Guide Of The Lotus" + }, + "/lotus/storeitems/upgrades/skins/sigils/masterysigil": { + "value": "Mastery Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/primeaccesssigilfive": { + "value": "Verlorum Prime Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/primetradersigil": { + "value": "Prisma Sigil " + }, + "/lotus/storeitems/upgrades/skins/sigils/ps4oneyearsigil": { + "value": "Cycle One Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/sparksigil": { + "value": "Flickering Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilarbitersofhexisa": { + "value": "Arbiter Of Hexis Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilarbitersofhexisb": { + "value": "Guiding Path Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilarbitersofhexisc": { + "value": "Bending Will Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilarbitersofhexisd": { + "value": "Discipline Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilarbitersofhexise": { + "value": "Will Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilarbitersofhexisf": { + "value": "Choice Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilarbitersofhexisg": { + "value": "Grasp Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilarbitersofhexish": { + "value": "Potential Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilarbitersofhexisi": { + "value": "Succession Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilarbitersofhexisj": { + "value": "Surpassing Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilarbitersofhexisk": { + "value": "Truth Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilcephalonsudaa": { + "value": "Cephalon Suda Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilcephalonsudab": { + "value": "Query Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilcephalonsudac": { + "value": "Searching Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilcephalonsudad": { + "value": "Pattern Match Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilcephalonsudae": { + "value": "Atomic Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilcephalonsudaf": { + "value": "Manifold Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilcephalonsudag": { + "value": "Fractal Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilcephalonsudah": { + "value": "Multivariate Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilcephalonsudai": { + "value": "Labyrinth Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilcephalonsudaj": { + "value": "Hexan Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilcephalonsudak": { + "value": "Oracle Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilconclavea": { + "value": "Conclave Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilconclaveb": { + "value": "Awakening Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilconclavec": { + "value": "Perception Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilconclaved": { + "value": "Awareness Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilconclavee": { + "value": "Revelation Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilconclavef": { + "value": "Diligence Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilconclaveg": { + "value": "Prudence Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilconclaveh": { + "value": "Discretion Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilconclavei": { + "value": "Ambition Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilconclavej": { + "value": "Volition Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilconclavek": { + "value": "Freedom Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilconclavel": { + "value": "Enlightenment Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilconclavem": { + "value": "Discovery Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilconclaven": { + "value": "Accord Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilnewlokaa": { + "value": "New Loka Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilnewlokab": { + "value": "Sacrifice Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilnewlokac": { + "value": "Seed Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilnewlokad": { + "value": "Rebirth Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilnewlokae": { + "value": "Growth Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilnewlokaf": { + "value": "Clarity Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilnewlokag": { + "value": "Bloom Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilnewlokah": { + "value": "Purity Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilnewlokai": { + "value": "Gaia Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilnewlokaj": { + "value": "Bounty Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilnewlokak": { + "value": "Humanity Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilperrinsequencea": { + "value": "Perrin Sequence Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilperrinsequenceb": { + "value": "Progress Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilperrinsequencec": { + "value": "Opportunity Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilperrinsequenced": { + "value": "Calculating Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilperrinsequencee": { + "value": "Synergy Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilperrinsequencef": { + "value": "Directives Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilperrinsequenceg": { + "value": "Strategy Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilperrinsequenceh": { + "value": "Tessilations Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilperrinsequencei": { + "value": "Optimum Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilperrinsequencej": { + "value": "Capital Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilperrinsequencek": { + "value": "Chairman Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilredveila": { + "value": "Red Veil Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilredveilb": { + "value": "Blades Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilredveilc": { + "value": "Cull Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilredveild": { + "value": "Threat Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilredveile": { + "value": "Maelstrom Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilredveilf": { + "value": "Lesion Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilredveilg": { + "value": "Ruin Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilredveilh": { + "value": "Viscera Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilredveili": { + "value": "Malevolent Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilredveilj": { + "value": "Covert Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilredveilk": { + "value": "Assassin Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilsteelmeridiana": { + "value": "Steel Meridian Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilsteelmeridianb": { + "value": "Defiance Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilsteelmeridianc": { + "value": "Armada Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilsteelmeridiand": { + "value": "Vigilance Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilsteelmeridiane": { + "value": "Uprising Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilsteelmeridianf": { + "value": "Protectorate Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilsteelmeridiang": { + "value": "Freedom Fighter Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilsteelmeridianh": { + "value": "Armored Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilsteelmeridiani": { + "value": "Rebellion Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilsteelmeridianj": { + "value": "Unyielding Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/syndicatesigilsteelmeridiank": { + "value": "Champion Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/tennolive2015sigil": { + "value": "Tenno Live Sigil" + }, + "/lotus/storeitems/upgrades/skins/sigils/twotonesigil": { + "value": "Glyphed Sigil" + }, + "/lotus/storeitems/upgrades/skins/sony/excaliburpsplusskin": { + "value": "Excalibur Obsidian" + }, + "/lotus/storeitems/upgrades/skins/sony/excaliburpsplusskinhelmet": { + "value": "Excalibur Obsidian Helmet" + }, + "/lotus/storeitems/upgrades/skins/sony/obsidiancoltekmask": { + "value": "Coltek Obsidian Sentinel Mask" + }, + "/lotus/storeitems/upgrades/skins/sony/obsidiangorgon": { + "value": "Gorgon Obsidian Skin" + }, + "/lotus/storeitems/upgrades/skins/sony/obsidianhelios": { + "value": "Helios Obsidian Skin" + }, + "/lotus/storeitems/upgrades/skins/sony/obsidiantwinvipers": { + "value": "Twin Vipers Obsidian Skin" + }, + "/lotus/storeitems/upgrades/skins/sony/obsidianviper": { + "value": "Viper Obsidian Skin" + }, + "/lotus/storeitems/upgrades/skins/sony/obsidianwyrm": { + "value": "Wyrm Obsidian Skin" + }, + "/lotus/storeitems/upgrades/skins/sony/ps4braton": { + "value": "Braton Obsidian Skin" + }, + "/lotus/storeitems/upgrades/skins/sony/ps4lato": { + "value": "Lato Obsidian Skin" + }, + "/lotus/storeitems/upgrades/skins/sony/ps4mk1braton": { + "value": "Braton Obsidian Skin" + }, + "/lotus/storeitems/upgrades/skins/sony/ps4skana": { + "value": "Skana Obsidian Skin" + }, + "/lotus/storeitems/upgrades/skins/spectres/bronzespectrecustomization": { + "value": "Helmet Or Syandana" + }, + "/lotus/storeitems/upgrades/skins/spectres/goldspectrecustomization": { + "value": "Helmet Or Syandana" + }, + "/lotus/storeitems/upgrades/skins/spectres/platinumspectrecustomization": { + "value": "Helmet Or Syandana" + }, + "/lotus/storeitems/upgrades/skins/spectres/silverspectrecustomization": { + "value": "Helmet Or Syandana" + }, + "/lotus/storeitems/upgrades/skins/spectres/spectrecustomization": { + "value": "Helmet Or Syandana" + }, + "/lotus/storeitems/upgrades/skins/summersolstice/summersolsticetwingrakatas": { + "value": "Twin Grakata Towsun Skin" + }, + "/lotus/storeitems/upgrades/skins/tengu/tenguagileanims": { + "value": "Zephyr Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/tengu/tengualtbhelmet": { + "value": "Zephyr Tengu Helmet" + }, + "/lotus/storeitems/upgrades/skins/tengu/tengualthelmet": { + "value": "Zephyr Cierzo Helmet" + }, + "/lotus/storeitems/upgrades/skins/tengu/tenguhelmet": { + "value": "Zephyr Helmet" + }, + "/lotus/storeitems/upgrades/skins/tengu/tengunobleanims": { + "value": "Zephyr Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/tengu/unlocktenguagile": { + "value": "Zephyr Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/tengu/unlocktengunoble": { + "value": "Zephyr Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/tengu/zephyralternateskin": { + "value": "Zephyr Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/trapper/trapperagileanims": { + "value": "Vauban Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/trapper/trapperdefaulthelmet": { + "value": "Vauban Helmet" + }, + "/lotus/storeitems/upgrades/skins/trapper/trapperhelmetalt": { + "value": "Arcane Esprit Helmet" + }, + "/lotus/storeitems/upgrades/skins/trapper/trapperhelmetaltb": { + "value": "Arcane Gambit Helmet" + }, + "/lotus/storeitems/upgrades/skins/trapper/trapperhelmetaltbstatless": { + "value": "Vauban Gambit Helmet" + }, + "/lotus/storeitems/upgrades/skins/trapper/trapperhelmetaltstatless": { + "value": "Vauban Esprit Helmet" + }, + "/lotus/storeitems/upgrades/skins/trapper/trapperhelmetsoldier": { + "value": "Vauban Armistice Helmet" + }, + "/lotus/storeitems/upgrades/skins/trapper/trappernobleanims": { + "value": "Vauban Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/trapper/unlocktrapperagile": { + "value": "Vauban Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/trapper/unlocktrappernoble": { + "value": "Vauban Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/trapper/vaubanalternateskin": { + "value": "Vauban Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/trapper/vaubanvoidskin": { + "value": "Vauban Phased Skin" + }, + "/lotus/storeitems/upgrades/skins/trapper/vaubanvoidskinhelmet": { + "value": "Vauban Phased Helmet" + }, + "/lotus/storeitems/upgrades/skins/trinity/trinityagileanims": { + "value": "Trinity Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/trinity/trinityalternateskin": { + "value": "Trinity Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/trinity/trinityhelmet": { + "value": "Trinity Helmet" + }, + "/lotus/storeitems/upgrades/skins/trinity/trinityhelmetalt": { + "value": "Arcane Aura Helmet" + }, + "/lotus/storeitems/upgrades/skins/trinity/trinityhelmetaltb": { + "value": "Arcane Meridian Helmet" + }, + "/lotus/storeitems/upgrades/skins/trinity/trinityhelmetaltbstatless": { + "value": "Trinity Meridian Helmet" + }, + "/lotus/storeitems/upgrades/skins/trinity/trinityhelmetaltstatless": { + "value": "Trinity Aura Helmet" + }, + "/lotus/storeitems/upgrades/skins/trinity/trinitynobleanims": { + "value": "Trinity Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/trinity/unlocktrinityagile": { + "value": "Trinity Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/trinity/unlocktrinitynoble": { + "value": "Trinity Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/valentinesday/valentinesarrow": { + "value": "Eros Arrow Skin" + }, + "/lotus/storeitems/upgrades/skins/voidtrader/baroarrow": { + "value": "Ki'Teer Arrow" + }, + "/lotus/storeitems/upgrades/skins/voidtrader/baroinarospolearmskin": { + "value": "Anpu Staff Skin" + }, + "/lotus/storeitems/upgrades/skins/voidtrader/elixissonicor": { + "value": "Sonicor Exilis Skin" + }, + "/lotus/storeitems/upgrades/skins/voidtrader/prismaarrow": { + "value": "Prisma Arrows" + }, + "/lotus/storeitems/upgrades/skins/voidtrader/vtexcaliburavalonhelmet": { + "value": "Excalibur Prisma Avalon Helmet" + }, + "/lotus/storeitems/upgrades/skins/voidtrader/vtexcaliburhelmet": { + "value": "Excalibur Prisma Helmet" + }, + "/lotus/storeitems/upgrades/skins/voidtrader/vtexcaliburpendragonhelmet": { + "value": "Excalibur Prisma Pendragon Helmet" + }, + "/lotus/storeitems/upgrades/skins/voidtrader/vtexcaliburskin": { + "value": "Excalibur Prisma Skin" + }, + "/lotus/storeitems/upgrades/skins/voidtrader/vthalloweendarksword": { + "value": "Dark Sword Day of the Dead Skin" + }, + "/lotus/storeitems/upgrades/skins/voidtrader/vtquanta": { + "value": "Quanta Aufeis Skin" + }, + "/lotus/storeitems/upgrades/skins/voidtrader/vtredeemerskin": { + "value": "Elixis Redeemer Skin" + }, + "/lotus/storeitems/upgrades/skins/volt/unlockvoltagile": { + "value": "Volt Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/volt/unlockvoltnoble": { + "value": "Volt Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/volt/voltagileanims": { + "value": "Volt Agile Animation Set" + }, + "/lotus/storeitems/upgrades/skins/volt/voltalternateskin": { + "value": "Volt Immortal Skin" + }, + "/lotus/storeitems/upgrades/skins/volt/volthelmet": { + "value": "Volt Helmet" + }, + "/lotus/storeitems/upgrades/skins/volt/volthelmetalt": { + "value": "Arcane Storm Helmet" + }, + "/lotus/storeitems/upgrades/skins/volt/volthelmetaltb": { + "value": "Arcane Pulse Helmet" + }, + "/lotus/storeitems/upgrades/skins/volt/volthelmetaltbstatless": { + "value": "Volt Pulse Helmet" + }, + "/lotus/storeitems/upgrades/skins/volt/volthelmetaltstatless": { + "value": "Volt Storm Helmet" + }, + "/lotus/storeitems/upgrades/skins/volt/voltnobleanims": { + "value": "Volt Noble Animation Set" + }, + "/lotus/storeitems/upgrades/skins/volt/voltprimehelmet": { + "value": "Volt Prime Helmet" + }, + "/lotus/storeitems/weapons/cephalon/primary/cephprimary/cephprimary": { + "value": "Simulor" + }, + "/lotus/storeitems/weapons/clantech/bio/aciddartpistol": { + "value": "Acrid" + }, + "/lotus/storeitems/weapons/clantech/bio/bioweapon": { + "value": "Torid" + }, + "/lotus/storeitems/weapons/clantech/chemical/flamethrower": { + "value": "Ignis" + }, + "/lotus/storeitems/weapons/clantech/chemical/rocketlauncher": { + "value": "Ogris" + }, + "/lotus/storeitems/weapons/clantech/energy/crpheavyrifle": { + "value": "Supra" + }, + "/lotus/storeitems/weapons/clantech/energy/crplaserpistol": { + "value": "Spectra" + }, + "/lotus/storeitems/weapons/clantech/energy/crplaserrifle": { + "value": "Flux Rifle" + }, + "/lotus/storeitems/weapons/clantech/energy/deravandal": { + "value": "Dera Vandal" + }, + "/lotus/storeitems/weapons/clantech/energy/electroprod": { + "value": "Prova" + }, + "/lotus/storeitems/weapons/clantech/energy/energyrifle": { + "value": "Dera" + }, + "/lotus/storeitems/weapons/clantech/energy/railgun": { + "value": "Lanka" + }, + "/lotus/storeitems/weapons/clantech/energy/vandalelectroprod": { + "value": "Prova Vandal" + }, + "/lotus/storeitems/weapons/corpus/longguns/chainlightninggun/chainlightningrifle": { + "value": "Amprex" + }, + "/lotus/storeitems/weapons/corpus/longguns/corpusump/corpusump": { + "value": "Tetra" + }, + "/lotus/storeitems/weapons/corpus/longguns/corpusump/prismacorpusump": { + "value": "Prisma Tetra" + }, + "/lotus/storeitems/weapons/corpus/longguns/crpbfg/crpbfg": { + "value": "Opticor" + }, + "/lotus/storeitems/weapons/corpus/longguns/crpfreezeray/crpfreezerayrifle": { + "value": "Glaxion" + }, + "/lotus/storeitems/weapons/corpus/longguns/crpshockrifle/crpshockrifle": { + "value": "Quanta" + }, + "/lotus/storeitems/weapons/corpus/longguns/crpshockrifle/quantavandal": { + "value": "Quanta Vandal" + }, + "/lotus/storeitems/weapons/corpus/longguns/grenadelauncher/grenadelauncher": { + "value": "Penta" + }, + "/lotus/storeitems/weapons/corpus/melee/kickandpunch/kickpunchweapon": { + "value": "Obex" + }, + "/lotus/storeitems/weapons/corpus/melee/polearm/corpuspolearm01/corpuspolearmweapon": { + "value": "Serro" + }, + "/lotus/storeitems/weapons/corpus/melee/whip/corpuswhipweapon": { + "value": "Lecta" + }, + "/lotus/storeitems/weapons/corpus/pistols/corpushandshotgun/corpushandcannon": { + "value": "Detron" + }, + "/lotus/storeitems/weapons/corpus/pistols/corpusminigun/corpusminigun": { + "value": "Cestra" + }, + "/lotus/storeitems/weapons/corpus/pistols/corpusminigun/dualcorpusminigun": { + "value": "Dual Cestra" + }, + "/lotus/storeitems/weapons/corpus/pistols/crpairpistol/crpairpistolarray": { + "value": "Gammacor" + }, + "/lotus/storeitems/weapons/corpus/pistols/crphandrl/corpushandrocketlauncher": { + "value": "Angstrum" + }, + "/lotus/storeitems/weapons/corpus/pistols/crphandrl/prismaangstrum": { + "value": "Prisma Angstrum" + }, + "/lotus/storeitems/weapons/grineer/grineerpistol/grineerakimbopistol": { + "value": "Twin Gremlins" + }, + "/lotus/storeitems/weapons/grineer/grineerpistol/grineerlightpistol": { + "value": "Viper" + }, + "/lotus/storeitems/weapons/grineer/grineerpistol/grnheavypistol": { + "value": "Kraken" + }, + "/lotus/storeitems/weapons/grineer/grineerpistol/grnscopedpistolplayer": { + "value": "Seer" + }, + "/lotus/storeitems/weapons/grineer/longguns/acidprimary/acidrifle": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/weapons/grineer/longguns/burstrifle/grnburstrifle": { + "value": "Hind" + }, + "/lotus/storeitems/weapons/grineer/longguns/grineerassaultrifle/grnassaultrifle": { + "value": "Grakata" + }, + "/lotus/storeitems/weapons/grineer/longguns/grineerflakcannon/flakcannon": { + "value": "Drakgoon" + }, + "/lotus/storeitems/weapons/grineer/longguns/grineerleveractionrifle/glarifle": { + "value": "Grinlok" + }, + "/lotus/storeitems/weapons/grineer/longguns/grineerm16homage/grineerm16rifle": { + "value": "Karak" + }, + "/lotus/storeitems/weapons/grineer/longguns/grineerm16homage/karakwraith": { + "value": "Karak Wraith" + }, + "/lotus/storeitems/weapons/grineer/longguns/grineersawbladegun/sawbladegun": { + "value": "Miter" + }, + "/lotus/storeitems/weapons/grineer/longguns/grineersniperrifle/grnsniperrifle": { + "value": "Vulkar" + }, + "/lotus/storeitems/weapons/grineer/longguns/grngorgsniperrifle/grngorgsniperrifle": { + "value": "Buzlok" + }, + "/lotus/storeitems/weapons/grineer/longguns/grngrenadelauncher/grngrenadelauncher": { + "value": "Tonkor" + }, + "/lotus/storeitems/weapons/grineer/longguns/grnharpoongun/grnharpoongun": { + "value": "Gorgon" + }, + "/lotus/storeitems/weapons/grineer/longguns/grnspark/grnsparkrifle": { + "value": "Kohm" + }, + "/lotus/storeitems/weapons/grineer/longguns/voidtradergorgon/vtgorgon": { + "value": "Prisma Gorgon" + }, + "/lotus/storeitems/weapons/grineer/longguns/wraithgorgon/wraithgorgon": { + "value": "Gorgon Wraith" + }, + "/lotus/storeitems/weapons/grineer/melee/grineerclaws/grnclaws": { + "value": "Ripkas" + }, + "/lotus/storeitems/weapons/grineer/melee/grineercombatknife/grineercombatknife": { + "value": "Sheev" + }, + "/lotus/storeitems/weapons/grineer/melee/grineerjetpoweredpolearm/grineerjetpolearm": { + "value": "Jat Kittag" + }, + "/lotus/storeitems/weapons/grineer/melee/grineermachetteandcleaver/dualcleaverweapon": { + "value": "Dual Cleavers" + }, + "/lotus/storeitems/weapons/grineer/melee/grineermachetteandcleaver/machete": { + "value": "Machete" + }, + "/lotus/storeitems/weapons/grineer/melee/grineermachetteandcleaver/prismadualcleavers": { + "value": "Prisma Dual Cleavers" + }, + "/lotus/storeitems/weapons/grineer/melee/grineermachetteandcleaver/wraithmacheteweapon": { + "value": "Machete Wraith" + }, + "/lotus/storeitems/weapons/grineer/melee/grineertylaxeandboar/regoraxeshield": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/weapons/grineer/melee/grineerwhip/grineerwhip": { + "value": "Atterax" + }, + "/lotus/storeitems/weapons/grineer/melee/grnboomerang/grnboomerang": { + "value": "Halikar" + }, + "/lotus/storeitems/weapons/grineer/pistols/grineercrossbow/grineergoogun": { + "value": "Stug" + }, + "/lotus/storeitems/weapons/grineer/pistols/grineerhandshotgun/grineerhandcannon": { + "value": "Brakk" + }, + "/lotus/storeitems/weapons/grineer/pistols/grineerleveractionpistol/glapistol": { + "value": "Marelok" + }, + "/lotus/storeitems/weapons/grineer/pistols/grineermicrowavegun/grnmicrowavepistol": { + "value": "Nukor" + }, + "/lotus/storeitems/weapons/grineer/pistols/grndwuniques/grntwinburstpistols": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/weapons/grineer/pistols/grnkohmpistol/grnkohmpistol": { + "value": "Kohmak" + }, + "/lotus/storeitems/weapons/grineer/pistols/heatgun/grnheatgun": { + "value": "Atomos" + }, + "/lotus/storeitems/weapons/grineer/pistols/voidtraderbrakk/vtbrakk": { + "value": "Mara Brakk" + }, + "/lotus/storeitems/weapons/grineer/pistols/wraithsingleviper/wraithsingleviper": { + "value": "Wraith Viper" + }, + "/lotus/storeitems/weapons/grineer/pistols/wraithtwinvipers/wraithtwinvipers": { + "value": "Wraith Twin Vipers" + }, + "/lotus/storeitems/weapons/infested/longguns/infcrpshockswarm/infcrpshockswarmrifle": { + "value": "Mutalist Quanta" + }, + "/lotus/storeitems/weapons/infested/longguns/infestedrifle": { + "value": "Synapse" + }, + "/lotus/storeitems/weapons/infested/longguns/quantafullyinfested/infquantarifle": { + "value": "Paracyst" + }, + "/lotus/storeitems/weapons/infested/longguns/tentacluster/infestedshotgun": { + "value": "Phage" + }, + "/lotus/storeitems/weapons/infested/melee/glaives/punctureglaive/punctureglaiveweapon": { + "value": "Cerata" + }, + "/lotus/storeitems/weapons/infested/melee/swords/mire/miresword": { + "value": "Mire" + }, + "/lotus/storeitems/weapons/infested/melee/swords/swordwhip/infswordwhip": { + "value": "Mire" + }, + "/lotus/storeitems/weapons/infested/melee/whip/infestedwhip/infestedwhipweapon": { + "value": "Scoliac" + }, + "/lotus/storeitems/weapons/infested/pistols/infesteddartpistol/infesteddartpistol": { + "value": "Tysis" + }, + "/lotus/storeitems/weapons/infested/pistols/infestedpistol": { + "value": "Embolist" + }, + "/lotus/storeitems/weapons/mk1series/mk1bo": { + "value": "Mk1-bo" + }, + "/lotus/storeitems/weapons/mk1series/mk1braton": { + "value": "Mk1-braton" + }, + "/lotus/storeitems/weapons/mk1series/mk1fang": { + "value": "Mk1-fang" + }, + "/lotus/storeitems/weapons/mk1series/mk1fragor": { + "value": "Mk1-fragor" + }, + "/lotus/storeitems/weapons/mk1series/mk1furax": { + "value": "Mk1-furax" + }, + "/lotus/storeitems/weapons/mk1series/mk1furis": { + "value": "Mk1-furis" + }, + "/lotus/storeitems/weapons/mk1series/mk1kunai": { + "value": "Mk1-kunai" + }, + "/lotus/storeitems/weapons/mk1series/mk1latron": { + "value": "Mk1-latron" + }, + "/lotus/storeitems/weapons/mk1series/mk1lex": { + "value": "Mk1-lex" + }, + "/lotus/storeitems/weapons/mk1series/mk1paris": { + "value": "Mk1-paris" + }, + "/lotus/storeitems/weapons/mk1series/mk1skana": { + "value": "Mk1-skana" + }, + "/lotus/storeitems/weapons/mk1series/mk1strun": { + "value": "Mk1-strun" + }, + "/lotus/storeitems/weapons/syndicates/arbitersofhexis/pistols/ahakbolto": { + "value": "Telos Akbolto" + }, + "/lotus/storeitems/weapons/syndicates/cephalonsuda/pistols/csdroidarray": { + "value": "Gammacor" + }, + "/lotus/storeitems/weapons/syndicates/cephalonsuda/pistols/cssynoidgammacor": { + "value": "Synoid Gammacor" + }, + "/lotus/storeitems/weapons/syndicates/newloka/pistols/nlcastanas": { + "value": "Sancti Castanas" + }, + "/lotus/storeitems/weapons/syndicates/perrinsequence/pistols/psdualcestra": { + "value": "Secura Dual Cestra" + }, + "/lotus/storeitems/weapons/syndicates/redveil/pistols/rvballistica": { + "value": "Rakta Ballistica" + }, + "/lotus/storeitems/weapons/syndicates/steelmeridian/pistols/smmarelok": { + "value": "Vaykor Marelok" + }, + "/lotus/storeitems/weapons/tenno/akimbo/akimboautopistols": { + "value": "Afuris" + }, + "/lotus/storeitems/weapons/tenno/akimbo/akimbobolto": { + "value": "Akbolto" + }, + "/lotus/storeitems/weapons/tenno/akimbo/akimbopistol": { + "value": "Aklato" + }, + "/lotus/storeitems/weapons/tenno/akimbo/akimboshotgun": { + "value": "Akbronco" + }, + "/lotus/storeitems/weapons/tenno/akimbo/akimboviperpistols": { + "value": "Twin Vipers" + }, + "/lotus/storeitems/weapons/tenno/akimbo/aklexpistols": { + "value": "Aklex" + }, + "/lotus/storeitems/weapons/tenno/akimbo/dualmagnus": { + "value": "Akmagnus" + }, + "/lotus/storeitems/weapons/tenno/akimbo/dualvastos": { + "value": "Akvasto" + }, + "/lotus/storeitems/weapons/tenno/akimbo/primeakimboshotgun": { + "value": "Akbronco Prime" + }, + "/lotus/storeitems/weapons/tenno/archwing/melee/archaxe/archaxeweapon": { + "value": "Onorix" + }, + "/lotus/storeitems/weapons/tenno/archwing/melee/archhammer/archhammer": { + "value": "Rathbone" + }, + "/lotus/storeitems/weapons/tenno/archwing/melee/archsword/archswordweapon": { + "value": "Veritux" + }, + "/lotus/storeitems/weapons/tenno/archwing/melee/archswordandshield/archswordshield": { + "value": "Centaur" + }, + "/lotus/storeitems/weapons/tenno/archwing/melee/voidtraderarchsword/vtarchswordweapon": { + "value": "Prisma Veritux" + }, + "/lotus/storeitems/weapons/tenno/archwing/primary/archwingheavypistols/archheavypistols": { + "value": "Dual Decurion" + }, + "/lotus/storeitems/weapons/tenno/archwing/primary/foldingmachinegun/archmachinegun": { + "value": "Imperator" + }, + "/lotus/storeitems/weapons/tenno/archwing/primary/foldingmachinegun/archmachinegunvandal": { + "value": "Imperator Vandal" + }, + "/lotus/storeitems/weapons/tenno/archwing/primary/launchgrenade/archcannon": { + "value": "Corvas" + }, + "/lotus/storeitems/weapons/tenno/archwing/primary/railgun/archrailgun": { + "value": "Velocitus" + }, + "/lotus/storeitems/weapons/tenno/archwing/primary/repurposedgrineerantiaircraftgun/repurposedgrineerantiaircraftgun": { + "value": "Imperator" + }, + "/lotus/storeitems/weapons/tenno/archwing/primary/rocketartillery/archrocketcrossbow": { + "value": "Fluctus" + }, + "/lotus/storeitems/weapons/tenno/bows/antlerbow/antlerbow": { + "value": "Cernos" + }, + "/lotus/storeitems/weapons/tenno/bows/asymetricalbow/asymetricalbow": { + "value": "Daikyu" + }, + "/lotus/storeitems/weapons/tenno/bows/huntingbow": { + "value": "Paris" + }, + "/lotus/storeitems/weapons/tenno/bows/primehuntingbow": { + "value": "Paris Prime" + }, + "/lotus/storeitems/weapons/tenno/bows/stalkerbow": { + "value": "Dread" + }, + "/lotus/storeitems/weapons/tenno/longguns/dexthethird/dexthethird": { + "value": "Dex Sybaris" + }, + "/lotus/storeitems/weapons/tenno/longguns/doublebarrelshotgun/tennodoublebarrelshotgun": { + "value": "Tigris" + }, + "/lotus/storeitems/weapons/tenno/longguns/drakerifle/drakerifle": { + "value": "Tiberon" + }, + "/lotus/storeitems/weapons/tenno/longguns/miter/tnomiter": { + "value": "Panthera" + }, + "/lotus/storeitems/weapons/tenno/longguns/primeboltor/primeboltor": { + "value": "Boltor Prime" + }, + "/lotus/storeitems/weapons/tenno/longguns/primeburston/primeburston": { + "value": "Burston Prime" + }, + "/lotus/storeitems/weapons/tenno/longguns/primesoma/primesomarifle": { + "value": "Soma Prime" + }, + "/lotus/storeitems/weapons/tenno/longguns/primevectis/primevectisrifle": { + "value": "Vectis Prime" + }, + "/lotus/storeitems/weapons/tenno/longguns/tnoleveraction/tnoleveractionrifle": { + "value": "Sybaris" + }, + "/lotus/storeitems/weapons/tenno/longguns/tnoprmryxbow/tnoprmryxbowweapon": { + "value": "Attica" + }, + "/lotus/storeitems/weapons/tenno/longguns/wraithlatron/wraithlatron": { + "value": "Latron Wraith" + }, + "/lotus/storeitems/weapons/tenno/melee/axe/axeweapon": { + "value": "Scindo" + }, + "/lotus/storeitems/weapons/tenno/melee/axe/dualaxeweapon": { + "value": "Dual Zoren" + }, + "/lotus/storeitems/weapons/tenno/melee/axe/dualinfestedaxesweapon": { + "value": "Dual Ichor" + }, + "/lotus/storeitems/weapons/tenno/melee/axe/primescindo/primescindoweapon": { + "value": "Scindo Prime" + }, + "/lotus/storeitems/weapons/tenno/melee/brass knuckles/brassknuckles": { + "value": "Kogake" + }, + "/lotus/storeitems/weapons/tenno/melee/claws/tennoclaws": { + "value": "Venka" + }, + "/lotus/storeitems/weapons/tenno/melee/cronussword/cronuslongsword": { + "value": "Cronus" + }, + "/lotus/storeitems/weapons/tenno/melee/cronussword/primecronuslongsword": { + "value": "Dakra Prime" + }, + "/lotus/storeitems/weapons/tenno/melee/dagger/ceramicdagger": { + "value": "Ceramic Dagger" + }, + "/lotus/storeitems/weapons/tenno/melee/dagger/dagger": { + "value": "Heat Dagger" + }, + "/lotus/storeitems/weapons/tenno/melee/dagger/darkdagger": { + "value": "Dark Dagger" + }, + "/lotus/storeitems/weapons/tenno/melee/dualdagger/dualdagger": { + "value": "Fang" + }, + "/lotus/storeitems/weapons/tenno/melee/dualdagger/dualetherdagger": { + "value": "Ether Daggers" + }, + "/lotus/storeitems/weapons/tenno/melee/dualdagger/fangprimedagger": { + "value": "Fang Prime" + }, + "/lotus/storeitems/weapons/tenno/melee/dualkamas/dualkamas": { + "value": "Dual Kamas" + }, + "/lotus/storeitems/weapons/tenno/melee/dualkamas/singlekama": { + "value": "Kama" + }, + "/lotus/storeitems/weapons/tenno/melee/dualshortsword/dualethersword": { + "value": "Dual Ether" + }, + "/lotus/storeitems/weapons/tenno/melee/dualshortsword/dualheatswords": { + "value": "Dual Heat Swords" + }, + "/lotus/storeitems/weapons/tenno/melee/dualshortsword/dualshortsword": { + "value": "Dual Skana" + }, + "/lotus/storeitems/weapons/tenno/melee/fist/fist": { + "value": "Furax" + }, + "/lotus/storeitems/weapons/tenno/melee/fist/furaxwraith": { + "value": "Furax Wraith" + }, + "/lotus/storeitems/weapons/tenno/melee/gauntlet/gauntlet": { + "value": "Ankyros" + }, + "/lotus/storeitems/weapons/tenno/melee/gauntlet/primeankyros/primeankyros": { + "value": "Ankyros Prime" + }, + "/lotus/storeitems/weapons/tenno/melee/glaives/boomerang/boomerangweapon": { + "value": "Kestrel" + }, + "/lotus/storeitems/weapons/tenno/melee/glaives/lightglaive/lightglaiveweapon": { + "value": "Glaive" + }, + "/lotus/storeitems/weapons/tenno/melee/glaives/primeglaive/primeglaiveweapon": { + "value": "Glaive Prime" + }, + "/lotus/storeitems/weapons/tenno/melee/greatsword/greatsword": { + "value": "Gram" + }, + "/lotus/storeitems/weapons/tenno/melee/gunblade/tnogunblade": { + "value": "Redeemer" + }, + "/lotus/storeitems/weapons/tenno/melee/hammer/hammerweapon": { + "value": "Fragor" + }, + "/lotus/storeitems/weapons/tenno/melee/longsword/ethersword": { + "value": "Ether Sword" + }, + "/lotus/storeitems/weapons/tenno/melee/longsword/longsword": { + "value": "Skana" + }, + "/lotus/storeitems/weapons/tenno/melee/longsword/skanaprime": { + "value": "Skana Prime" + }, + "/lotus/storeitems/weapons/tenno/melee/maces/paladinmace/paladinmaceweapon": { + "value": "Magistar" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/axecmbonemeleetree": { + "value": "Rending Crane" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/axecmbthreemeleetree": { + "value": "Tempo Royale" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/axecmbtwomeleetree": { + "value": "Cleaving Whirlwind" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/clawcmbonemeleetree": { + "value": "Malicious Raptor" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/clawcmbthreemeleetree": { + "value": "Four Riders" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/clawcmbtwomeleetree": { + "value": "Vermillion Storm" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/crimsondervishmeleetree": { + "value": "Crimson Dervish" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/daggercmbonemeleetree": { + "value": "Homing Fang" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/daggercmbtwomeleetree": { + "value": "Pointed Wind" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/dualdaggercmbonemeleetree": { + "value": "Sinking Talon" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/dualdaggercmbtwomeleetree": { + "value": "Gnashing Payara" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/dualswordcmbonemeleetree": { + "value": "Swirling Tiger" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/dualswordcmbtwomeleetree": { + "value": "Crossing Snakes" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/fistcmbonemeleetree": { + "value": "Fracturing Wind" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/fistcmbtwomeleetree": { + "value": "Seismic Palm" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/glaivecmbonemeleetree": { + "value": "Gleaming Talon" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/glaivecmbtwomeleetree": { + "value": "Astral Twilight" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/gunbladecmbonemeleetree": { + "value": "High Noon" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/hammercmbonemeleetree": { + "value": "Shattering Storm" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/hammercmbtwomeleetree": { + "value": "Crushing Ruin" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/ironphoenixmeleetree": { + "value": "Iron Phoenix" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/katanacmbonemeleetree": { + "value": "Tranquil Cleave" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/katanacmbthreemeleetree": { + "value": "Blind Justice" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/katanacmbtwomeleetree": { + "value": "Decisive Judgement" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/machetecmbonemeleetree": { + "value": "Sundering Weave" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/polearmcmbonemeleetree": { + "value": "Shimmering Blight" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/polearmcmbtwomeleetree": { + "value": "Bleeding Willow" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/punchkickcmbonemeleetree": { + "value": "Grim Fury" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/punchkickcmbtwomeleetree": { + "value": "Brutal Tide" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/scythecmbonemeleetree": { + "value": "Reaping Spiral" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/scythecmbtwomeleetree": { + "value": "Stalking Fan" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/staffcmbonemeleetree": { + "value": "Clashing Forest" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/staffcmbtwomeleetree": { + "value": "Flailing Branch" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/swordshieldcmbonemeleetree": { + "value": "Eleventh Storm" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/tonfacmbonemeleetree": { + "value": "Gemini Cross" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/whipcmbonemeleetree": { + "value": "Burning Wasp" + }, + "/lotus/storeitems/weapons/tenno/melee/meleetrees/whipcmbtwomeleetree": { + "value": "Coiling Viper" + }, + "/lotus/storeitems/weapons/tenno/melee/nunchaku/cynunchaku/cynunchaku": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/weapons/tenno/melee/polearms/flowerpowerpolearm/flowerpowerpolearmwep": { + "value": "Tonbo" + }, + "/lotus/storeitems/weapons/tenno/melee/polearms/polearmweapon": { + "value": "Orthos" + }, + "/lotus/storeitems/weapons/tenno/melee/polearms/primepolearmweapon": { + "value": "Orthos Prime" + }, + "/lotus/storeitems/weapons/tenno/melee/scythe/etherscytheweapon": { + "value": "Ether Reaper" + }, + "/lotus/storeitems/weapons/tenno/melee/scythe/parisscythe/parisscythe": { + "value": "Anku" + }, + "/lotus/storeitems/weapons/tenno/melee/scythe/reaperweapon": { + "value": "Reaper Prime" + }, + "/lotus/storeitems/weapons/tenno/melee/scythe/stalkerscytheweapon": { + "value": "Hate" + }, + "/lotus/storeitems/weapons/tenno/melee/soma/somadualkamas": { + "value": "Dual Raza" + }, + "/lotus/storeitems/weapons/tenno/melee/staff/basestaff": { + "value": "Bo" + }, + "/lotus/storeitems/weapons/tenno/melee/staff/grnstaff": { + "value": "Amphis" + }, + "/lotus/storeitems/weapons/tenno/melee/staff/monkspade/tnomonkstaff": { + "value": "Tipedo" + }, + "/lotus/storeitems/weapons/tenno/melee/staff/primebo/primeboweapon": { + "value": "Bo Prime" + }, + "/lotus/storeitems/weapons/tenno/melee/staff/staff": { + "value": "Bo" + }, + "/lotus/storeitems/weapons/tenno/melee/swords/cutlassandpoignard/cutlasspoignardswords": { + "value": "Nami Skyla" + }, + "/lotus/storeitems/weapons/tenno/melee/swords/cutlassandpoignard/tennocutlass": { + "value": "Nami Solo" + }, + "/lotus/storeitems/weapons/tenno/melee/swords/darksword/darklongsword": { + "value": "Dark Sword" + }, + "/lotus/storeitems/weapons/tenno/melee/swords/dexthesecond/dexthesecond": { + "value": "Dex Dakra" + }, + "/lotus/storeitems/weapons/tenno/melee/swords/greatsword/tennogreatsword": { + "value": "Galatine" + }, + "/lotus/storeitems/weapons/tenno/melee/swords/heatsword/heatlongsword": { + "value": "Heat Sword" + }, + "/lotus/storeitems/weapons/tenno/melee/swords/jawsword/jawlongsword": { + "value": "Jaw Sword" + }, + "/lotus/storeitems/weapons/tenno/melee/swords/katanaandwakizashi/katana": { + "value": "Nikana" + }, + "/lotus/storeitems/weapons/tenno/melee/swords/katanaandwakizashi/lowkatana": { + "value": "Dragon Nikana" + }, + "/lotus/storeitems/weapons/tenno/melee/swords/krisdagger/krisdagger": { + "value": "Karyst" + }, + "/lotus/storeitems/weapons/tenno/melee/swords/pangolinsword/pangolinlongsword": { + "value": "Pangolin Sword" + }, + "/lotus/storeitems/weapons/tenno/melee/swords/plasmasword/plasmalongsword": { + "value": "Plasma Sword" + }, + "/lotus/storeitems/weapons/tenno/melee/swordsandboards/meleecontestwinnerone/tennoswordshield": { + "value": "Silva & Aegis" + }, + "/lotus/storeitems/weapons/tenno/melee/tonfa/boltonfa/boltonfa": { + "value": "Boltace" + }, + "/lotus/storeitems/weapons/tenno/melee/tonfa/tonfacontestwinner/tennotonfa": { + "value": "Kronen" + }, + "/lotus/storeitems/weapons/tenno/pistol/autopistol": { + "value": "Furis" + }, + "/lotus/storeitems/weapons/tenno/pistol/broncoprime": { + "value": "Bronco Prime" + }, + "/lotus/storeitems/weapons/tenno/pistol/burstpistol": { + "value": "Sicarus" + }, + "/lotus/storeitems/weapons/tenno/pistol/crossbow": { + "value": "Bolto" + }, + "/lotus/storeitems/weapons/tenno/pistol/handshotgun": { + "value": "Bronco" + }, + "/lotus/storeitems/weapons/tenno/pistol/heavypistol": { + "value": "Lex" + }, + "/lotus/storeitems/weapons/tenno/pistol/latoprime": { + "value": "Lato Prime" + }, + "/lotus/storeitems/weapons/tenno/pistol/latovandal": { + "value": "Lato Vandal" + }, + "/lotus/storeitems/weapons/tenno/pistol/pistol": { + "value": "Lato" + }, + "/lotus/storeitems/weapons/tenno/pistol/revolverpistol": { + "value": "Vasto" + }, + "/lotus/storeitems/weapons/tenno/pistols/automatichandcrossbow/autocrossbow": { + "value": "Ballistica" + }, + "/lotus/storeitems/weapons/tenno/pistols/dexfuris/dexfuris": { + "value": "Dex Furis" + }, + "/lotus/storeitems/weapons/tenno/pistols/harlequingun/harlequinpistols": { + "value": "Akzani" + }, + "/lotus/storeitems/weapons/tenno/pistols/magnum/magnum": { + "value": "Magnus" + }, + "/lotus/storeitems/weapons/tenno/pistols/primelex/primelex": { + "value": "Lex Prime" + }, + "/lotus/storeitems/weapons/tenno/pistols/primesicarus/primesicaruspistol": { + "value": "Sicarus Prime" + }, + "/lotus/storeitems/weapons/tenno/pistols/primevasto/primevastopistol": { + "value": "Vasto Prime" + }, + "/lotus/storeitems/weapons/tenno/pistols/sawnoffshotgun/tennohandshotgun": { + "value": "Pyrana" + }, + "/lotus/storeitems/weapons/tenno/pistols/somasidearm/akimbosomapistols": { + "value": "Aksomati" + }, + "/lotus/storeitems/weapons/tenno/pistols/tennouzi/tennouzi": { + "value": "Akstiletto" + }, + "/lotus/storeitems/weapons/tenno/pistols/tigrisredeemersetpistol/tnobladedpistols": { + "value": "Akjagara" + }, + "/lotus/storeitems/weapons/tenno/pistols/tigristwin/tigristwin": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/weapons/tenno/rifle/boltorifle": { + "value": "Boltor" + }, + "/lotus/storeitems/weapons/tenno/rifle/bratonprime": { + "value": "Braton Prime" + }, + "/lotus/storeitems/weapons/tenno/rifle/burstrifle": { + "value": "Burston" + }, + "/lotus/storeitems/weapons/tenno/rifle/heavyrifle": { + "value": "Gorgon" + }, + "/lotus/storeitems/weapons/tenno/rifle/latronprime": { + "value": "Latron Prime" + }, + "/lotus/storeitems/weapons/tenno/rifle/rifle": { + "value": "Braton" + }, + "/lotus/storeitems/weapons/tenno/rifle/semiautorifle": { + "value": "Latron" + }, + "/lotus/storeitems/weapons/tenno/rifle/sniperrifle": { + "value": "Snipetron" + }, + "/lotus/storeitems/weapons/tenno/rifle/startingrifle": { + "value": "Mk1-braton" + }, + "/lotus/storeitems/weapons/tenno/rifle/tennoar": { + "value": "Soma" + }, + "/lotus/storeitems/weapons/tenno/rifle/tennosniperrifle": { + "value": "Vectis" + }, + "/lotus/storeitems/weapons/tenno/rifle/vandalsniperrifle": { + "value": "Snipetron Vandal" + }, + "/lotus/storeitems/weapons/tenno/rifle/viprifle": { + "value": "Braton Vandal" + }, + "/lotus/storeitems/weapons/tenno/shotgun/doublebarrelshotgun": { + "value": "Sobek" + }, + "/lotus/storeitems/weapons/tenno/shotgun/fullautoshotgun": { + "value": "Boar" + }, + "/lotus/storeitems/weapons/tenno/shotgun/primeboar": { + "value": "Boar Prime" + }, + "/lotus/storeitems/weapons/tenno/shotgun/quadshotgun": { + "value": "Hek" + }, + "/lotus/storeitems/weapons/tenno/shotgun/shotgun": { + "value": "Strun" + }, + "/lotus/storeitems/weapons/tenno/shotgun/shotgunvandal": { + "value": "Strun Wraith" + }, + "/lotus/storeitems/weapons/tenno/throwingweapons/cylidagger/cylidagger": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/weapons/tenno/throwingweapons/kunai": { + "value": "Kunai" + }, + "/lotus/storeitems/weapons/tenno/throwingweapons/lidagger/lidagger": { + "value": "[Placeholder]" + }, + "/lotus/storeitems/weapons/tenno/throwingweapons/primethrowingstar/primehikou": { + "value": "Hikou Prime" + }, + "/lotus/storeitems/weapons/tenno/throwingweapons/stalkerkunai": { + "value": "Despair" + }, + "/lotus/storeitems/weapons/tenno/throwingweapons/stickybomb/stickybombs": { + "value": "Castanas" + }, + "/lotus/storeitems/weapons/tenno/throwingweapons/tennostars": { + "value": "Hikou" + }, + "/lotus/storeitems/weapons/voidtrader/prismagrakata": { + "value": "Prisma Grakata" + }, + "/lotus/storeitems/weapons/voidtrader/prismaskana": { + "value": "Prisma Skana" + }, + "/lotus/storeitems/weapons/voidtrader/vtdetron": { + "value": "Detron Mara" + }, + "/lotus/types/boosterpacks/randomprojection": { + "value": "Relic Pack" + }, + "/lotus/types/enemies/acolytes/areacasteracolyteagent": { + "value": "Misery" + }, + "/lotus/types/enemies/acolytes/areacasteracolyteavatar": { + "value": "Area Caster Acolyte Avatar" + }, + "/lotus/types/enemies/acolytes/controlacolyteagent": { + "value": "Torment" + }, + "/lotus/types/enemies/acolytes/duellistacolyteagent": { + "value": "Violence" + }, + "/lotus/types/enemies/acolytes/heavyacolyteagent": { + "value": "Malice" + }, + "/lotus/types/enemies/acolytes/rogueacolyteagent": { + "value": "Mania" + }, + "/lotus/types/enemies/acolytes/rogueacolyteavatar": { + "value": "Rogue Acolyte Avatar" + }, + "/lotus/types/enemies/acolytes/strikeracolyteagent": { + "value": "Angst" + }, + "/lotus/types/enemies/acolytes/strikeracolyteavatar": { + "value": "Striker Acolyte Avatar" + }, + "/lotus/types/enemies/capturetargets/capturetargetcorpus": { + "value": "Capture Target Corpus" + }, + "/lotus/types/enemies/capturetargets/capturetargetcorpusnullifieravatar": { + "value": "Capture Target Corpus Nullifier Avatar" + }, + "/lotus/types/enemies/capturetargets/capturetargetgrineer": { + "value": "Capture Target Grineer" + }, + "/lotus/types/enemies/capturetargets/capturetargetmarooavatar": { + "value": "Capture Target Ma Roo Avatar" + }, + "/lotus/types/enemies/corpus/bipedrobot/aiweek/lasercannonbipedavatarleader": { + "value": "Laser Cannon Biped Avatar Leader" + }, + "/lotus/types/enemies/corpus/bipedrobot/aiweek/laserdiscbipedavatarleader": { + "value": "Laser Disc Biped Avatar Leader" + }, + "/lotus/types/enemies/corpus/bipedrobot/aiweek/railgunbipedavatarleader": { + "value": "Railgun Biped Avatar Leader" + }, + "/lotus/types/enemies/corpus/bipedrobot/aiweek/riotbipedcontrolavatar": { + "value": "Riot Biped Control Avatar" + }, + "/lotus/types/enemies/corpus/bipedrobot/aiweek/riotbipeddispersionavatar": { + "value": "Riot Biped Dispersion Avatar" + }, + "/lotus/types/enemies/corpus/bipedrobot/aiweek/riotbipedpreventionavatar": { + "value": "Riot Biped Prevention Avatar" + }, + "/lotus/types/enemies/corpus/bipedrobot/aiweek/shockwavebipedavatarleader": { + "value": "Shockwave Biped Avatar Leader" + }, + "/lotus/types/enemies/corpus/bipedrobot/aiweek/supermoabipedavatarleader": { + "value": "Super Moa Biped Avatar Leader" + }, + "/lotus/types/enemies/corpus/drones/aiweek/discdroneavatar": { + "value": "Disc Drone Avatar" + }, + "/lotus/types/enemies/corpus/drones/aiweek/discdroneavatarleader": { + "value": "Disc Drone Avatar Leader" + }, + "/lotus/types/enemies/corpus/drones/aiweek/leechdroneavatarleader": { + "value": "Leech Drone Avatar Leader" + }, + "/lotus/types/enemies/corpus/drones/aiweek/minedroneavatarleader": { + "value": "Mine Drone Avatar Leader" + }, + "/lotus/types/enemies/corpus/drones/aiweek/shielddroneavatarleader": { + "value": "Shield Drone Avatar Leader" + }, + "/lotus/types/enemies/corpus/drones/aiweek/suicidedroneavatar": { + "value": "Suicide Drone Avatar" + }, + "/lotus/types/enemies/corpus/drones/aiweek/vacdroneavatarleader": { + "value": "Vac Drone Avatar Leader" + }, + "/lotus/types/enemies/corpus/gamemodes/deployablespacemanwardenavatar": { + "value": "Deployable Spaceman Warden Avatar" + }, + "/lotus/types/enemies/corpus/gamemodes/deployablespacemanwardenavatarleader": { + "value": "Deployable Spaceman Warden Avatar Leader" + }, + "/lotus/types/enemies/corpus/quadrobot/microhyenaavatar": { + "value": "Micro Hyena Avatar" + }, + "/lotus/types/enemies/corpus/quadrobot/miniboss/quadrobotminibossavatar": { + "value": "Quad Robot Mini Boss Avatar" + }, + "/lotus/types/enemies/corpus/quadrobot/miniboss/shielddroneminibossavatar": { + "value": "Shield Drone Mini Boss Avatar" + }, + "/lotus/types/enemies/corpus/quadrobot/miniboss/turretquadminibossavatar": { + "value": "Turret Quad Mini Boss Avatar" + }, + "/lotus/types/enemies/corpus/spaceman/aiweek/carrierspacemanavatar": { + "value": "Carrier Spaceman Avatar" + }, + "/lotus/types/enemies/corpus/spaceman/aiweek/deployablespacemanavatarleader": { + "value": "Deployable Spaceman Avatar Leader" + }, + "/lotus/types/enemies/corpus/spaceman/aiweek/nullifyspacemanavatar": { + "value": "Nullify Spaceman Avatar" + }, + "/lotus/types/enemies/corpus/spaceman/aiweek/nullifyspacemanavatarleader": { + "value": "Nullify Spaceman Avatar Leader" + }, + "/lotus/types/enemies/corpus/spaceman/aiweek/riflespacemanavatarleader": { + "value": "Rifle Spaceman Avatar Leader" + }, + "/lotus/types/enemies/corpus/spaceman/aiweek/shotgunspacemanavatarleader": { + "value": "Shotgun Spaceman Avatar Leader" + }, + "/lotus/types/enemies/corpus/spaceman/aiweek/sniperspacemanavatarleader": { + "value": "Sniper Spaceman Avatar Leader" + }, + "/lotus/types/enemies/corpus/spaceman/elitespacemanavatarleader": { + "value": "Elite Spaceman Avatar Leader" + }, + "/lotus/types/enemies/corpus/spaceman/modularspacemanavatarskatinglaser": { + "value": "Modular Spaceman Avatar Skating Laser" + }, + "/lotus/types/enemies/corpus/spaceman/modularspacemanavatarskatingshield": { + "value": "Modular Spaceman Avatar Skating Shield" + }, + "/lotus/types/enemies/corpus/spaceman/modularspacemanavatarskatingtesla": { + "value": "Modular Spaceman Avatar Skating Tesla" + }, + "/lotus/types/enemies/corpus/spaceman/modularspacemanavatarwalkinglaser": { + "value": "Modular Spaceman Avatar Walking Laser" + }, + "/lotus/types/enemies/corpus/spaceman/modularspacemanavatarwalkingshield": { + "value": "Modular Spaceman Avatar Walking Shield" + }, + "/lotus/types/enemies/corpus/spaceman/modularspacemanavatarwalkingtesla": { + "value": "Modular Spaceman Avatar Walking Tesla" + }, + "/lotus/types/enemies/corpus/turrets/turretavatars/autoturretheavyavatar": { + "value": "Auto Turret Heavy Avatar" + }, + "/lotus/types/enemies/corpus/turrets/turretavatars/securitycameranarrowavatar": { + "value": "Security Camera Narrow Avatar" + }, + "/lotus/types/enemies/corpus/vip/hyena/hyenagunavatar": { + "value": "Hyena Gun Avatar" + }, + "/lotus/types/enemies/corpuschampions/teama/ccteamarifleavatar": { + "value": "C C Team A Rifle Avatar" + }, + "/lotus/types/enemies/corpuschampions/teama/ccteamaskateavatar": { + "value": "C C Team A Skate Avatar" + }, + "/lotus/types/enemies/corpuschampions/teama/ccteamaskatebavatar": { + "value": "C C Team A Skate B Avatar" + }, + "/lotus/types/enemies/corpuschampions/teama/ccteamazanukaavatar": { + "value": "C C Team A Zanuka Avatar" + }, + "/lotus/types/enemies/corpuschampions/teamb/ccteambdisruptoravatar": { + "value": "C C Team B Disruptor Avatar" + }, + "/lotus/types/enemies/corpuschampions/teamb/ccteambhyenaavatar": { + "value": "C C Team B Hyena Avatar" + }, + "/lotus/types/enemies/corpuschampions/teamb/ccteambospreyavatar": { + "value": "C C Team B Osprey Avatar" + }, + "/lotus/types/enemies/corpuschampions/teamb/ccteambriotmoaavatar": { + "value": "C C Team B Riot Moa Avatar" + }, + "/lotus/types/enemies/corpuschampions/teamc/ccteamcdeceptionavatar": { + "value": "C C Team C Deception Avatar" + }, + "/lotus/types/enemies/corpuschampions/teamc/ccteamcmoaavatar": { + "value": "C C Team C Moa Avatar" + }, + "/lotus/types/enemies/corpuschampions/teamc/ccteamcsimplifiedhackeravatar": { + "value": "C C Team C Simplified Hacker Avatar" + }, + "/lotus/types/enemies/corpuschampions/teamc/ccteamcstealthavatar": { + "value": "C C Team C Stealth Avatar" + }, + "/lotus/types/enemies/corpuschampions/teamd/ccteamdbusteraavatar": { + "value": "C C Team D Buster A Avatar" + }, + "/lotus/types/enemies/corpuschampions/teamd/ccteamdbusterbavatar": { + "value": "C C Team D Buster B Avatar" + }, + "/lotus/types/enemies/corpuschampions/teamd/ccteamdbustercavatar": { + "value": "C C Team D Buster C Avatar" + }, + "/lotus/types/enemies/corpuschampions/teamd/ccteamdospreyavatar": { + "value": "C C Team D Osprey Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/beastmasteravatar": { + "value": "Beast Master Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/bladesawmanavatarleader": { + "value": "Blade Sawman Avatar Leader" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/carrierriflelanceravatar": { + "value": "Carrier Rifle Lancer Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/catmasteravatar": { + "value": "Cat Master Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/combatcatbrowavatar": { + "value": "Combat Catbrow Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/combatkubrowavatar": { + "value": "Combat Kubrow Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/eliteriflelanceravatarleader": { + "value": "Elite Rifle Lancer Avatar Leader" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/eviseratorlanceravatar": { + "value": "Eviserator Lancer Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/femalegrineeravatarleader": { + "value": "Female Grineer Avatar Leader" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/flamelanceravatarleader": { + "value": "Flame Lancer Avatar Leader" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/grineerdefectoravatar": { + "value": "Grineer Defector Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/grineermeleestaffavatar": { + "value": "Grineer Melee Staff Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/grineermeleestaffavatarleader": { + "value": "Grineer Melee Staff Avatar Leader" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/heavyfemalegrineeravatarleader": { + "value": "Heavy Female Grineer Avatar Leader" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/incendiarybombardavatarleader": { + "value": "Incendiary Bombard Avatar Leader" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/jetpackmarineavatar": { + "value": "Jetpack Marine Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/jetpackmarinecarrieravatar": { + "value": "Jetpack Marine Carrier Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/jetpackmeleeavatar": { + "value": "Jetpack Melee Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/jetpacksniperavatar": { + "value": "Jetpack Sniper Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/machetewomanavatarleader": { + "value": "Machete Woman Avatar Leader" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/manicgrineeravatar": { + "value": "Manic Grineer Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/nightwatchmanicavatar": { + "value": "Nightwatch Manic Avatar" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/pistonsawmanavatarleader": { + "value": "Piston Sawman Avatar Leader" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/riflelanceravatarleader": { + "value": "Rifle Lancer Avatar Leader" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/rocketbombardavatarleader": { + "value": "Rocket Bombard Avatar Leader" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/rollingdroneavatarleader": { + "value": "Rolling Drone Avatar Leader" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/shieldlanceravatarleader": { + "value": "Shield Lancer Avatar Leader" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/shotgunlanceravatarleader": { + "value": "Shotgun Lancer Avatar Leader" + }, + "/lotus/types/enemies/grineer/aiweek/avatars/stickyrollingdroneavatar": { + "value": "Sticky Rolling Drone Avatar" + }, + "/lotus/types/enemies/grineer/deathsquad/avatars/deathsquadavatara": { + "value": "Death Squad Avatar A" + }, + "/lotus/types/enemies/grineer/deathsquad/avatars/deathsquadavatarb": { + "value": "Death Squad Avatar B" + }, + "/lotus/types/enemies/grineer/deathsquad/avatars/deathsquadavatarc": { + "value": "Death Squad Avatar C" + }, + "/lotus/types/enemies/grineer/deathsquad/avatars/deathsquadsentinelavatar": { + "value": "Death Squad Sentinel Avatar" + }, + "/lotus/types/enemies/grineer/desert/avatars/bladesawmanavatarleader": { + "value": "Blade Sawman Avatar Leader" + }, + "/lotus/types/enemies/grineer/desert/avatars/eliteriflelanceravatarleader": { + "value": "Elite Rifle Lancer Avatar Leader" + }, + "/lotus/types/enemies/grineer/desert/avatars/riflelanceravatarleader": { + "value": "Rifle Lancer Avatar Leader" + }, + "/lotus/types/enemies/grineer/forest/avatars/bladesawmanavatarleader": { + "value": "Blade Sawman Avatar Leader" + }, + "/lotus/types/enemies/grineer/forest/avatars/evisceratorlanceravatarleader": { + "value": "Eviscerator Lancer Avatar Leader" + }, + "/lotus/types/enemies/grineer/forest/avatars/riflelanceravatarleader": { + "value": "Rifle Lancer Avatar Leader" + }, + "/lotus/types/enemies/grineer/forest/avatars/shotgunlanceravatarleader": { + "value": "Shotgun Lancer Avatar Leader" + }, + "/lotus/types/enemies/grineer/forest/heavyfemalegrineeravatardesertleader": { + "value": "Heavy Female Grineer Avatar Desert Leader" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortressbeastmasteravatar": { + "value": "Fortress Beast Master Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortressbladesawmanavatar": { + "value": "Fortress Blade Sawman Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortresscombatkubrowavatar": { + "value": "Fortress Combat Kubrow Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortresseliteriflelanceravatar": { + "value": "Fortress Elite Rifle Lancer Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortressfemalegrineeravatar": { + "value": "Fortress Female Grineer Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortressflamelanceravatar": { + "value": "Fortress Flame Lancer Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortressgrineermarinepistolavatar": { + "value": "Fortress Grineer Marine Pistol Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortressheavyfemalegrineeravatar": { + "value": "Fortress Heavy Female Grineer Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortressincendiarybombardavatar": { + "value": "Fortress Incendiary Bombard Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortressmachetewomanavatar": { + "value": "Fortress Machete Woman Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortresspistonsawmanavatar": { + "value": "Fortress Piston Sawman Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortressriflelanceravatar": { + "value": "Fortress Rifle Lancer Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortressrocketbombardavatar": { + "value": "Fortress Rocket Bombard Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortressrollingdroneavatar": { + "value": "Fortress Rolling Drone Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortressshieldlanceravatar": { + "value": "Fortress Shield Lancer Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/fortressshotgunlanceravatar": { + "value": "Fortress Shotgun Lancer Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/grineerautoflameturretavatar": { + "value": "Grineer Auto Flame Turret Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/grineerautorocketturretavatar": { + "value": "Grineer Auto Rocket Turret Avatar" + }, + "/lotus/types/enemies/grineer/fortress/avatars/grineerautoturretavatar": { + "value": "Grineer Auto Turret Avatar" + }, + "/lotus/types/enemies/grineer/gamemodes/wardengrineerheavyavatarleader": { + "value": "Warden Grineer Heavy Avatar Leader" + }, + "/lotus/types/enemies/grineer/gfssecuritycameranarrowavatar": { + "value": "Gfs Security Camera Narrow Avatar" + }, + "/lotus/types/enemies/grineer/gfssecuritycamerawallmounted": { + "value": "Gfs Security Camera Wall Mounted" + }, + "/lotus/types/enemies/grineer/grineerautoturretstaticavatar": { + "value": "Grineer Auto Turret Static Avatar" + }, + "/lotus/types/enemies/grineer/grineeravatars/grineermarinepistolavatarleader": { + "value": "Grineer Marine Pistol Avatar Leader" + }, + "/lotus/types/enemies/grineer/sealab/avatars/bladesawmanavatar": { + "value": "Blade Sawman Avatar" + }, + "/lotus/types/enemies/grineer/sealab/avatars/eliteriflelanceravatar": { + "value": "Elite Rifle Lancer Avatar" + }, + "/lotus/types/enemies/grineer/sealab/avatars/femalegrineermacheteavatar": { + "value": "Female Grineer Machete Avatar" + }, + "/lotus/types/enemies/grineer/sealab/avatars/femalegrineersniperavatar": { + "value": "Female Grineer Sniper Avatar" + }, + "/lotus/types/enemies/grineer/sealab/avatars/riflelanceravatar": { + "value": "Rifle Lancer Avatar" + }, + "/lotus/types/enemies/grineer/sealab/avatars/sealabmanicbombardavatar": { + "value": "Sea Lab Manic Bombard Avatar" + }, + "/lotus/types/enemies/grineer/sealab/avatars/sealabmanicgrineeravatar": { + "value": "Sea Lab Manic Grineer Avatar" + }, + "/lotus/types/enemies/grineer/sealab/avatars/shotgunlanceravatar": { + "value": "Shotgun Lancer Avatar" + }, + "/lotus/types/enemies/grineer/specialevents/forestdroneavatar": { + "value": "Forest Drone Avatar" + }, + "/lotus/types/enemies/grineer/vip/hek/hekbipedavatar": { + "value": "Hek Biped Avatar" + }, + "/lotus/types/enemies/grineer/vip/hek/hekdroneavatar": { + "value": "Hek Drone Avatar" + }, + "/lotus/types/enemies/grineer/vip/hek/propdrones/propdroneavatar": { + "value": "Prop Drone Avatar" + }, + "/lotus/types/enemies/grineer/vip/hek/propdrones/strikedroneavatar": { + "value": "Strike Drone Avatar" + }, + "/lotus/types/enemies/grineer/vip/tylregor/tylregoravatar": { + "value": "Tyl Regor Avatar" + }, + "/lotus/types/enemies/grineer/vip/vortwo/vortwobossavatar": { + "value": "Vor Two Boss Avatar" + }, + "/lotus/types/enemies/grineerchampions/grineerchampionbeastmasteravatar": { + "value": "Grineer Champion Beastmaster Avatar" + }, + "/lotus/types/enemies/grineerchampions/grineerchampionchargeravatar": { + "value": "Grineer Champion Charger Avatar" + }, + "/lotus/types/enemies/grineerchampions/grineerchampionengineeravatar": { + "value": "Grineer Champion Engineer Avatar" + }, + "/lotus/types/enemies/grineerchampions/grineerchampiongruntavatar": { + "value": "Grineer Champion Grunt Avatar" + }, + "/lotus/types/enemies/grineerchampions/grineerchampionhealeravatar": { + "value": "Grineer Champion Healer Avatar" + }, + "/lotus/types/enemies/grineerchampions/grineerchampionheavyavatar": { + "value": "Grineer Champion Heavy Avatar" + }, + "/lotus/types/enemies/grineerchampions/grineerchampionjetpackavatar": { + "value": "Grineer Champion Jetpack Avatar" + }, + "/lotus/types/enemies/grineerchampions/grineerchampionsniperavatar": { + "value": "Grineer Champion Sniper Avatar" + }, + "/lotus/types/enemies/grineerchampions/grineerchampionsniperdecoyavatar": { + "value": "Grineer Champion Sniper Decoy Avatar" + }, + "/lotus/types/enemies/grineerchampions/grineerchampiontankavatar": { + "value": "Grineer Champion Tank Avatar" + }, + "/lotus/types/enemies/infested/aiweek/ancients/ancientavatarleader": { + "value": "Ancient Avatar Leader" + }, + "/lotus/types/enemies/infested/aiweek/ancients/diseasedancientavatar": { + "value": "Diseased Ancient Avatar" + }, + "/lotus/types/enemies/infested/aiweek/ancients/diseasedancientavatarleader": { + "value": "Diseased Ancient Avatar Leader" + }, + "/lotus/types/enemies/infested/aiweek/ancients/healingancientavatarleader": { + "value": "Healing Ancient Avatar Leader" + }, + "/lotus/types/enemies/infested/aiweek/ancients/pussblobdeco": { + "value": "Puss Blob Deco" + }, + "/lotus/types/enemies/infested/aiweek/ancients/spawningancientavatar": { + "value": "Spawning Ancient Avatar" + }, + "/lotus/types/enemies/infested/aiweek/ancients/spawningancientavatarleader": { + "value": "Spawning Ancient Avatar Leader" + }, + "/lotus/types/enemies/infested/aiweek/ancients/toxicancientavatarleader": { + "value": "Toxic Ancient Avatar Leader" + }, + "/lotus/types/enemies/infested/aiweek/crawlers/grenadeavatar": { + "value": "Grenade Avatar" + }, + "/lotus/types/enemies/infested/aiweek/crawlers/grenadeavatarleader": { + "value": "Grenade Avatar Leader" + }, + "/lotus/types/enemies/infested/aiweek/crawlers/lightningavatar": { + "value": "Lightning Avatar" + }, + "/lotus/types/enemies/infested/aiweek/crawlers/lightningavatarleader": { + "value": "Lightning Avatar Leader" + }, + "/lotus/types/enemies/infested/aiweek/crawlers/noxiouscrawleravatar": { + "value": "Noxious Crawler Avatar" + }, + "/lotus/types/enemies/infested/aiweek/infesteddrones/cellcarrierdroneavatar": { + "value": "Cell Carrier Drone Avatar" + }, + "/lotus/types/enemies/infested/aiweek/infesteddrones/poisondroneavatar": { + "value": "Poison Drone Avatar" + }, + "/lotus/types/enemies/infested/aiweek/infestedmoas/nanitecloudbipedavatar": { + "value": "Nanite Cloud Biped Avatar" + }, + "/lotus/types/enemies/infested/aiweek/infestedmoas/nanitecloudbipedavatarleader": { + "value": "Nanite Cloud Biped Avatar Leader" + }, + "/lotus/types/enemies/infested/aiweek/infestedmoas/slowbombbipedavatar": { + "value": "Slow Bomb Biped Avatar" + }, + "/lotus/types/enemies/infested/aiweek/infestedmoas/slowbombbipedavatarleader": { + "value": "Slow Bomb Biped Avatar Leader" + }, + "/lotus/types/enemies/infested/aiweek/quadrupeds/juggernautavatar": { + "value": "Juggernaut Avatar" + }, + "/lotus/types/enemies/infested/aiweek/quadrupeds/juggernautavatarboss": { + "value": "Juggernaut Avatar Boss" + }, + "/lotus/types/enemies/infested/aiweek/quadrupeds/quadrupedavatar": { + "value": "Quadruped Avatar" + }, + "/lotus/types/enemies/infested/aiweek/quadrupeds/quadrupedavatarleader": { + "value": "Quadruped Avatar Leader" + }, + "/lotus/types/enemies/infested/aiweek/quadrupeds/rusheravatar": { + "value": "Rusher Avatar" + }, + "/lotus/types/enemies/infested/aiweek/runners/leapingrunneravatar": { + "value": "Leaping Runner Avatar" + }, + "/lotus/types/enemies/infested/aiweek/runners/leapingrunneravatarleader": { + "value": "Leaping Runner Avatar Leader" + }, + "/lotus/types/enemies/infested/aiweek/runners/runneravatar": { + "value": "Runner Avatar" + }, + "/lotus/types/enemies/infested/aiweek/runners/suiciderunneravatar": { + "value": "Suicide Runner Avatar" + }, + "/lotus/types/enemies/infested/vip/avatars/golemfullavatar": { + "value": "Golem Full Avatar" + }, + "/lotus/types/enemies/infested/vip/avatars/golemgrenadeheadavatar": { + "value": "Golem Grenade Head Avatar" + }, + "/lotus/types/enemies/infested/vip/avatars/golemgunheadavatar": { + "value": "Golem Gun Head Avatar" + }, + "/lotus/types/enemies/infested/vip/avatars/golemmeleeheadavatar": { + "value": "Golem Melee Head Avatar" + }, + "/lotus/types/enemies/infested/vip/avatars/hitproxies/golembodyblockingproxy": { + "value": "Golem Body Blocking Proxy" + }, + "/lotus/types/enemies/infested/vip/avatars/hitproxies/golemheadbodyblockingproxy": { + "value": "Golem Head Body Blocking Proxy" + }, + "/lotus/types/enemies/infested/vip/avatars/quadrupedvipavatar": { + "value": "Quadruped V I P Avatar" + }, + "/lotus/types/enemies/infested/vip/avatars/zombieleaderavatar": { + "value": "Zombie Leader Avatar" + }, + "/lotus/types/enemies/infested/vip/golemfullgrenadeweakspothitproxy": { + "value": "Golem Full Grenade Weak Spot Hit Proxy" + }, + "/lotus/types/enemies/infested/vip/golemfullgunweakspothitproxy": { + "value": "Golem Full Gun Weak Spot Hit Proxy" + }, + "/lotus/types/enemies/infested/vip/golemfullmeleeweakspothitproxy": { + "value": "Golem Full Melee Weak Spot Hit Proxy" + }, + "/lotus/types/enemies/infested/vip/golemgrenadeweakspothitproxy": { + "value": "Golem Grenade Weak Spot Hit Proxy" + }, + "/lotus/types/enemies/infested/vip/golemgunweakspothitproxy": { + "value": "Golem Gun Weak Spot Hit Proxy" + }, + "/lotus/types/enemies/infested/vip/golemmeleesechitproxy": { + "value": "Golem Melee Sec Hit Proxy" + }, + "/lotus/types/enemies/infested/vip/golemmeleeweakspothitproxy": { + "value": "Golem Melee Weak Spot Hit Proxy" + }, + "/lotus/types/enemies/infested/vip/infestedgrenadedeco": { + "value": "Infested Grenade Deco" + }, + "/lotus/types/enemies/orokin/orokinautoturretavatar": { + "value": "Orokin Auto Turret Avatar" + }, + "/lotus/types/enemies/orokin/orokinbladesawmanavatar": { + "value": "Orokin Blade Sawman Avatar" + }, + "/lotus/types/enemies/orokin/orokinbladesawmanavatarleader": { + "value": "Orokin Blade Sawman Avatar Leader" + }, + "/lotus/types/enemies/orokin/orokindroneattackavatar": { + "value": "Orokin Drone Attack Avatar" + }, + "/lotus/types/enemies/orokin/orokinhealingancientavatar": { + "value": "Orokin Healing Ancient Avatar" + }, + "/lotus/types/enemies/orokin/orokinhealingancientleaderavatar": { + "value": "Orokin Healing Ancient Leader Avatar" + }, + "/lotus/types/enemies/orokin/orokinheavyfemaleavatar": { + "value": "Orokin Heavy Female Avatar" + }, + "/lotus/types/enemies/orokin/orokinheavyfemaleleaderavatar": { + "value": "Orokin Heavy Female Leader Avatar" + }, + "/lotus/types/enemies/orokin/orokinmoabipedavatar": { + "value": "Orokin Moa Biped Avatar" + }, + "/lotus/types/enemies/orokin/orokinmoabipedleaderavatar": { + "value": "Orokin Moa Biped Leader Avatar" + }, + "/lotus/types/enemies/orokin/orokinnullifyspacemanavatar": { + "value": "Orokin Nullify Spaceman Avatar" + }, + "/lotus/types/enemies/orokin/orokinnullifyspacemanavatarleader": { + "value": "Orokin Nullify Spaceman Avatar Leader" + }, + "/lotus/types/enemies/orokin/orokinrocketbombardavatar": { + "value": "Orokin Rocket Bombard Avatar" + }, + "/lotus/types/enemies/orokin/orokinrocketbombardavatarleader": { + "value": "Orokin Rocket Bombard Avatar Leader" + }, + "/lotus/types/enemies/orokin/orokinshielddroneavatar": { + "value": "Orokin Shield Drone Avatar" + }, + "/lotus/types/enemies/orokin/orokinshielddroneleaderavatar": { + "value": "Orokin Shield Drone Leader Avatar" + }, + "/lotus/types/enemies/orokin/riflelanceravatar": { + "value": "Rifle Lancer Avatar" + }, + "/lotus/types/enemies/orokin/riflelancerleaderavatar": { + "value": "Rifle Lancer Leader Avatar" + }, + "/lotus/types/enemies/orokin/riflespacemanavatar": { + "value": "Rifle Spaceman Avatar" + }, + "/lotus/types/enemies/orokin/riflespacemanleaderavatar": { + "value": "Rifle Spaceman Leader Avatar" + }, + "/lotus/types/enemies/quests/sandmanboss/inarosgolemavatar": { + "value": "Inaros Golem Avatar" + }, + "/lotus/types/enemies/quests/sandmanboss/sandmanbossavatar": { + "value": "Sandman Boss Avatar" + }, + "/lotus/types/enemies/quests/sandmanboss/sandmanreplicaavatar": { + "value": "Sandman Replica Avatar" + }, + "/lotus/types/enemies/sentients/scouts/scoutavatar": { + "value": "Scout Avatar" + }, + "/lotus/types/enemies/sentients/troopers/sentientmeleetrooperavatar": { + "value": "Sentient Melee Trooper Avatar" + }, + "/lotus/types/enemies/sentients/troopers/sentienttrooperavatar": { + "value": "Sentient Trooper Avatar" + }, + "/lotus/types/enemies/spacebattles/grineer/drones/grineerspacedroneavatar": { + "value": "Grineer Space Drone Avatar" + }, + "/lotus/types/enemies/spacebattles/grineer/drones/laserdroneavatar": { + "value": "Laser Drone Avatar" + }, + "/lotus/types/enemies/spacebattles/grineer/pods/combatpodavatar": { + "value": "Combat Pod Avatar" + }, + "/lotus/types/enemies/spacebattles/grineer/skiffs/grineerspacemarineavatar": { + "value": "Grineer Space Marine Avatar" + }, + "/lotus/types/enemies/spacebattles/grineer/skiffs/missileskiffavatarleader": { + "value": "Missile Skiff Avatar Leader" + }, + "/lotus/types/enemies/spacebattles/grineer/skiffs/shieldskiffavatar": { + "value": "Shield Skiff Avatar" + }, + "/lotus/types/enemies/stalker/sentientstalkeravatar": { + "value": "Sentient Stalker Avatar" + }, + "/lotus/types/enemies/stalker/stalkeravatar": { + "value": "Stalker Avatar" + }, + "/lotus/types/enemies/tennoreplicants/fairyquest/knavelokidecoyavatar": { + "value": "Knave Loki Decoy Avatar" + }, + "/lotus/types/enemies/tennoreplicants/syndicateallies/colonyrescueallies/colonistrescuesteelmeridianavatard": { + "value": "Colonist Rescue Steel Meridian Avatar D" + }, + "/lotus/types/enemies/tennoreplicants/syndicateallies/steelmeridianallyavatarb": { + "value": "Steel Meridian Ally Avatar B" + }, + "/lotus/types/enemies/tennoreplicants/tennoreplicantchromaavatar": { + "value": "Tenno Replicant Chroma Avatar" + }, + "/lotus/types/enemies/tennoreplicants/tennoreplicantchromaavatarderelict": { + "value": "Tenno Replicant Chroma Avatar Derelict" + }, + "/lotus/types/friendly/agents/coredefenseavatar": { + "value": "Core Defense Avatar" + }, + "/lotus/types/friendly/agents/defenseavatar": { + "value": "Defense Avatar" + }, + "/lotus/types/friendly/agents/defensecomputeravatar": { + "value": "Defense Computer Avatar" + }, + "/lotus/types/friendly/agents/defensecomputercorpusavatar": { + "value": "Defense Computer Corpus Avatar" + }, + "/lotus/types/friendly/agents/defensecomputerfortavatar": { + "value": "Defense Computer Fort Avatar" + }, + "/lotus/types/friendly/agents/defensecorepipeavatargrineer": { + "value": "Defense Core Pipe Avatar Grineer" + }, + "/lotus/types/friendly/agents/eventforestdefenseavatar": { + "value": "Event Forest Defense Avatar" + }, + "/lotus/types/friendly/agents/excavatoravatar": { + "value": "Excavator Avatar" + }, + "/lotus/types/friendly/agents/friendlyavatar": { + "value": "Friendly Avatar" + }, + "/lotus/types/friendly/agents/hivemode/infestedhiveavatare": { + "value": "Infested Hive Avatar E" + }, + "/lotus/types/friendly/agents/infestedbaitavatar": { + "value": "Infested Bait Avatar" + }, + "/lotus/types/friendly/agents/orokindefenseavatar": { + "value": "Orokin Defense Avatar" + }, + "/lotus/types/friendly/agents/orokinmobiledefenseavatar": { + "value": "Orokin Mobile Defense Avatar" + }, + "/lotus/types/friendly/agents/orokinsabotageconsoleavatar": { + "value": "Orokin Sabotage Console Avatar" + }, + "/lotus/types/friendly/agents/payloadatvavatar": { + "value": "Payload A T V Avatar" + }, + "/lotus/types/friendly/clemavatar": { + "value": "Clem Avatar" + }, + "/lotus/types/friendly/pets/kubrowpetavatar": { + "value": "Kubrow Pet Avatar" + }, + "/lotus/types/game/catbrowpet/catbrowgeneticsignature": { + "value": "Kavat Genetic Code" + }, + "/lotus/types/game/catbrowpet/cheshirecatbrowpetpowersuit": { + "value": "Smeeta" + }, + "/lotus/types/game/catbrowpet/mirrorcatbrowpetpowersuit": { + "value": "Adarza" + }, + "/lotus/types/game/decorations/miningmachineobjective": { + "value": "Mining Machine Objective" + }, + "/lotus/types/game/kubrowpet/adventurerkubrowpetpowersuit": { + "value": "Sahasa" + }, + "/lotus/types/game/kubrowpet/chargerkubrowpetpowersuit": { + "value": "Helminth Charger" + }, + "/lotus/types/game/kubrowpet/furtivekubrowpetpowersuit": { + "value": "Huras" + }, + "/lotus/types/game/kubrowpet/guardkubrowpetpowersuit": { + "value": "Raksa" + }, + "/lotus/types/game/kubrowpet/hunterkubrowpetpowersuit": { + "value": "Sunika" + }, + "/lotus/types/game/kubrowpet/patterns/helminthpetpatternclassic": { + "value": "Helminth Degenerate Pattern" + }, + "/lotus/types/game/kubrowpet/patterns/kubrowpetpatternxmasc": { + "value": "Arklut Gene-Masking Kit" + }, + "/lotus/types/game/kubrowpet/retrieverkubrowpetpowersuit": { + "value": "Chesa" + }, + "/lotus/types/game/library/targets/research1target": { + "value": "Lancer" + }, + "/lotus/types/game/library/targets/research2target": { + "value": "Anti Moa" + }, + "/lotus/types/game/library/targets/research3target": { + "value": "Arid Eviscerator" + }, + "/lotus/types/game/library/targets/research4target": { + "value": "Corrupted Ancient" + }, + "/lotus/types/game/library/targets/research5target": { + "value": "Crewman" + }, + "/lotus/types/game/library/targets/research6target": { + "value": "Runner" + }, + "/lotus/types/game/library/targets/research7target": { + "value": "Guardsman" + }, + "/lotus/types/game/miningmachineobjective": { + "value": "Mining Machine Objective" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/ghoulbountytablearewards": { + "value": "100 Endo, Lith Z1 Relic, Lith H2 Relic, Hunter Adrenaline, Encrypted Journal Fragment, Hunter Munitions, Stubba Blueprint, Hunter Track" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/ghoulbountytablebrewards": { + "value": "300 Endo, Neo K1 Relic, Neo B4 Relic, Hunter Recovery, Encrypted Journal Fragment, Hunter Synergy, Quartakk Blueprint, Hunter Command" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tieratablearewards": { + "value": "Redirection, Oxium x100, 1500 Credits Cache, 50 Endo, Iradite x15, Gara Chassis Blueprint, Point Blank, Streamline, Morphics x2" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tieratablebrewards": { + "value": "Pressure Point, Cryotic x100, 1500 Credit Cache, 50 Endo, Grokdrul x15, Gara Chassis Blueprint, Hornet Strike, Stretch, Morphics x2" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tieratablecrewards": { + "value": "Vitality, Plastids x200, 1500 Credits Cache, 50 Endo, Nistlepod x15, Gara Chassis Blueprint, Point Blank, Intensify, Gallium x2" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tierbtablearewards": { + "value": "Steel Fiber, 200 Oxium, 2500 Credit Cache, 100 Endo, Lith Z1 Relic, Gara Systems Blueprint, Charged Chamber, Burning Wasp, 2s Control Module" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tierbtablebrewards": { + "value": "Energy Inversion, Cryotic x200, 2500 Credits Cache, 100 Endo, Lith H2 Relic, Gara Systems Blueprint, Speed Trigger, Reaping Spiral, Neural Sensors x2" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tierbtablecrewards": { + "value": "Point Strike, Circuits x300, 2500 Credits Cache, 100 Endo, Lith Z1 Relic, Gara Systemes Blueprint, Enhanced Durability, Grim Fury, Orokin Cell x2" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tierctablearewards": { + "value": "Gladiator Aegis, MAdurai Lens, Cetus Wisp, 200 Endo, Meso O2 Relic, Gara Neuroptics Blueprint, Augur Accord, Shimmering Blight, Vigilante Supplies" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tierctablebrewards": { + "value": "Vigilante Armaments, Vazarin Lens, Unairu Lens, 200 Endo, Meso T1 Relic, Gara Neuroptics Blueprint, Gladiator Might, Fracturing Wind, Augur Seeker" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tierctablecrewards": { + "value": "Augur Pact, Naramon Lens, Zenurik Lens, 200 Endo, Meso T2 Relic, Gara Neuroptics Blueprint, Vigilante Fervor, Swirling Tiger, Gladiator Vice" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tierdtablearewards": { + "value": "Gladiator Rush, Unairu Lens, Madurai Lens, 300 Endo, Neo K1 Relic, Cetus Wisp, Augur Reach, Eleventh Storm, Vigilante Offense" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tierdtablebrewards": { + "value": "Vigilante Vigor, Zenurik Lens, Vazarin Lens, 300 Endo, Neo B4 Relic, Cetus Wisp, Gladiator Resolve, Gemini Cross, Augur Secrets" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tierdtablecrewards": { + "value": "Augur Message, Kuva x100, Naramon Lens, 300 Endo, Neo Z1 Relic, Cetus Wisp, Vigilante Pursuit, Sinking Talon, Gladiator Finesse" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tieretablearewards": { + "value": "Breath of the Eidolon x5, Axi K2 Relic, Cetus Wisp x2, Kuva x300, Furax Wraith Gauntlet, Carving Mantis, Eidolon Lens Blueprint" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tieretablebrewards": { + "value": "Breath of the Eidolon x5, Axi O2 Relic, Cetus Wisp x2, Kuva x300, Furax Wraith Right Gauntlet, Swooping Falcon, Eidolon Lens Blueprint" + }, + "/lotus/types/game/missiondecks/eidolonjobmissionrewards/tieretablecrewards": { + "value": "Breath of the Eidolon x5, Axi H3 Relic, Cetus Wisp x2, Kuva x300, Furax Wraith Blueprint, Twirling Spire, Eidolon Lens Blueprint" + }, + "/lotus/types/game/notepacks/bardcorpuspacka": { + "value": "Alpha Instruments" + }, + "/lotus/types/game/notepacks/bardcorpuspackb": { + "value": "Beta Instruments" + }, + "/lotus/types/game/notepacks/bardcorpuspackc": { + "value": "Gamma Instruments" + }, + "/lotus/types/game/notepacks/bardcorpuspackd": { + "value": "Delta Instruments" + }, + "/lotus/types/game/notepacks/bardgrineerpacka": { + "value": "Druk Instruments" + }, + "/lotus/types/game/solarrails/basicsolarrail": { + "value": "Solar Rail - Tower Class" + }, + "/lotus/types/gameplay/eidolon/jobs/assassinatebountyass": { + "value": "Assassinate the Commander" + }, + "/lotus/types/gameplay/eidolon/jobs/assassinatebountycap": { + "value": "Capture the New Grineer Commander" + }, + "/lotus/types/gameplay/eidolon/jobs/attritionbountycap": { + "value": "Capture Their Leader" + }, + "/lotus/types/gameplay/eidolon/jobs/attritionbountyext": { + "value": "Cull the Enemy" + }, + "/lotus/types/gameplay/eidolon/jobs/attritionbountylib": { + "value": "Weaken the Grineer Foothold" + }, + "/lotus/types/gameplay/eidolon/jobs/attritionbountysab": { + "value": "Sabotage the Enemy Supply Lines" + }, + "/lotus/types/gameplay/eidolon/jobs/capturebountycapone": { + "value": "Capture the Grineer Commander" + }, + "/lotus/types/gameplay/eidolon/jobs/capturebountycaptwo": { + "value": "Spy Catcher" + }, + "/lotus/types/gameplay/eidolon/jobs/events/ghoulalertbountyass": { + "value": "Eliminate A Ghoul Alpha" + }, + "/lotus/types/gameplay/eidolon/jobs/events/ghoulalertbountyext": { + "value": "Wipe out Ghoul Burial Grounds" + }, + "/lotus/types/gameplay/eidolon/jobs/events/ghoulalertbountyhunt": { + "value": "Purge a Massive Ghoul Burial Site" + }, + "/lotus/types/gameplay/eidolon/jobs/events/ghoulalertbountyres": { + "value": "Rescue the Ghoul Defector" + }, + "/lotus/types/gameplay/eidolon/jobs/events/infestedplainsbounty": { + "value": "Plague Star" + }, + "/lotus/types/gameplay/eidolon/jobs/reclamationbountycache": { + "value": "Find the Hidden Artifact" + }, + "/lotus/types/gameplay/eidolon/jobs/reclamationbountycap": { + "value": "Capture the Grineer Agent" + }, + "/lotus/types/gameplay/eidolon/jobs/reclamationbountytheft": { + "value": "Reclaim the Stolen Artifact" + }, + "/lotus/types/gameplay/eidolon/jobs/rescuebountyresc": { + "value": "Search and Rescue" + }, + "/lotus/types/gameplay/eidolon/jobs/sabotagebountysab": { + "value": "Sabotage Bounty" + }, + "/lotus/types/gameplay/grineer/brokenlight": { + "value": "Broken Light" + }, + "/lotus/types/gameplay/grineer/doorsensordeco": { + "value": "Door Sensor Deco" + }, + "/lotus/types/items/miscitems/actuator": { + "value": "Actuators" + }, + "/lotus/types/items/miscitems/alertium": { + "value": "Nitain Extract" + }, + "/lotus/types/items/miscitems/alloyplate": { + "value": "Alloy Plate" + }, + "/lotus/types/items/miscitems/alphacorruptorresource": { + "value": "Alpha Corruptor" + }, + "/lotus/types/items/miscitems/archwingnavcode": { + "value": "Orokin Archive" + }, + "/lotus/types/items/miscitems/argoncrystal": { + "value": "Argon Crystal" + }, + "/lotus/types/items/miscitems/beacon": { + "value": "Proof Fragment" + }, + "/lotus/types/items/miscitems/betacorruptorresource": { + "value": "Beta Corruptor" + }, + "/lotus/types/items/miscitems/bossnavcode": { + "value": "Lephantis Nav Coordinate" + }, + "/lotus/types/items/miscitems/circuits": { + "value": "Circuits" + }, + "/lotus/types/items/miscitems/controlmodule": { + "value": "Control Module" + }, + "/lotus/types/items/miscitems/cryotic": { + "value": "Cryotic" + }, + "/lotus/types/items/miscitems/dangerroomkey": { + "value": "Simulacrum Access Key" + }, + "/lotus/types/items/miscitems/datafragment": { + "value": "Tethra Data Fragments" + }, + "/lotus/types/items/miscitems/eventium": { + "value": "Synthula" + }, + "/lotus/types/items/miscitems/ferrite": { + "value": "Ferrite" + }, + "/lotus/types/items/miscitems/forma": { + "value": "Forma" + }, + "/lotus/types/items/miscitems/gallium": { + "value": "Gallium" + }, + "/lotus/types/items/miscitems/heknavcode": { + "value": "Vay Hek Nav Coordinate [Obsolete??]" + }, + "/lotus/types/items/miscitems/infestedaladcoordinate": { + "value": "Mutalist Alad V Nav Coordinate" + }, + "/lotus/types/items/miscitems/juggernautparta": { + "value": "Pulsating Tubercles" + }, + "/lotus/types/items/miscitems/juggernautpartb": { + "value": "Infected Palpators" + }, + "/lotus/types/items/miscitems/juggernautpartc": { + "value": "Chitinous Husk" + }, + "/lotus/types/items/miscitems/juggernautpartd": { + "value": "Severed Bile Sac" + }, + "/lotus/types/items/miscitems/libraryscannerdoublescanupgrade": { + "value": "Cross-matrix Widget" + }, + "/lotus/types/items/miscitems/libraryscannerrechargeupgrade": { + "value": "Sol-battery Widget" + }, + "/lotus/types/items/miscitems/libraryscannerscanspeedupgrade": { + "value": "Vector-thread Widget" + }, + "/lotus/types/items/miscitems/miragecode": { + "value": "Orokin Cipher" + }, + "/lotus/types/items/miscitems/morphic": { + "value": "Morphics" + }, + "/lotus/types/items/miscitems/nanospores": { + "value": "Nano Spores" + }, + "/lotus/types/items/miscitems/navcode": { + "value": "Nav Coordinate" + }, + "/lotus/types/items/miscitems/neuralsensor": { + "value": "Neural Sensors" + }, + "/lotus/types/items/miscitems/neurode": { + "value": "Neurodes" + }, + "/lotus/types/items/miscitems/omegaisotope": { + "value": "Omega Isotope" + }, + "/lotus/types/items/miscitems/orokincatalyst": { + "value": "Orokin Catalyst" + }, + "/lotus/types/items/miscitems/orokincell": { + "value": "Orokin Cell" + }, + "/lotus/types/items/miscitems/orokinreactor": { + "value": "Orokin Reactor" + }, + "/lotus/types/items/miscitems/oxiumalloy": { + "value": "Oxium" + }, + "/lotus/types/items/miscitems/plastids": { + "value": "Plastids" + }, + "/lotus/types/items/miscitems/polymerbundle": { + "value": "Polymer Bundle" + }, + "/lotus/types/items/miscitems/primebucks": { + "value": "Orokin Ducats" + }, + "/lotus/types/items/miscitems/rubedo": { + "value": "Rubedo" + }, + "/lotus/types/items/miscitems/salvage": { + "value": "Salvage" + }, + "/lotus/types/items/miscitems/stablecorruptorresource": { + "value": "Stable Corruptor" + }, + "/lotus/types/items/miscitems/tellurium": { + "value": "Tellurium" + }, + "/lotus/types/items/miscitems/utilityunlocker": { + "value": "Exilus Adapter" + }, + "/lotus/types/items/miscitems/vayhekcoordinatefragmenta": { + "value": "Delta Beacon" + }, + "/lotus/types/items/miscitems/vayhekcoordinatefragmentb": { + "value": "Gamma Beacon" + }, + "/lotus/types/items/miscitems/vayhekcoordinatefragmentc": { + "value": "Kappa Beacon" + }, + "/lotus/types/items/miscitems/vayhekcoordinatefragmentd": { + "value": "Omega Beacon" + }, + "/lotus/types/items/miscitems/voidteardrop": { + "value": "Void Traces" + }, + "/lotus/types/items/plants/daycommonplant": { + "value": "Day Common Plant" + }, + "/lotus/types/items/plants/dayrareplant": { + "value": "Day Rare Plant" + }, + "/lotus/types/items/plants/dayuncommonplant": { + "value": "Day Un Common Plant" + }, + "/lotus/types/items/plants/gftplantruksclawmatureplant": { + "value": "Gft Plant Ruks Claw Mature Plant" + }, + "/lotus/types/items/plants/mossgroundcoveraplant": { + "value": "Moss Ground Cover A Plant" + }, + "/lotus/types/items/plants/nightcommonplant": { + "value": "Night Common Plant" + }, + "/lotus/types/items/plants/nightrareplant": { + "value": "Night Rare Plant" + }, + "/lotus/types/items/plants/nightuncommonplant": { + "value": "Night Un Common Plant" + }, + "/lotus/types/items/plants/wildgingerbplant": { + "value": "Wild Ginger B Plant" + }, + "/lotus/types/items/plants/zencobralotusplant": { + "value": "Zen Cobra Lotus Plant" + }, + "/lotus/types/items/plants/zenpitcherplant": { + "value": "Zen Pitcher Plant" + }, + "/lotus/types/items/research/biocomponent": { + "value": "Mutagen Mass" + }, + "/lotus/types/items/research/chemcomponent": { + "value": "Detonite Injector" + }, + "/lotus/types/items/research/energycomponent": { + "value": "Fieldron" + }, + "/lotus/types/items/shipchristmasifier": { + "value": "Christmas Decorations" + }, + "/lotus/types/items/shipdecos/grineerchampionsheavybobblehead": { + "value": "Executioner Dhurnam - Noggle Statue" + }, + "/lotus/types/items/shipdecos/nezhabobblehead": { + "value": "Nezha - Noggle Statue" + }, + "/lotus/types/items/shipdecos/wukongbobblehead": { + "value": "Wukong - Noggle Statue" + }, + "/lotus/types/keys/orokincapturekeya": { + "value": "Orokin Void Tier I Capture Key" + }, + "/lotus/types/keys/orokinkeya": { + "value": "Tower I Exterminate" + }, + "/lotus/types/keys/raidkeys/raid01stage01keyitem": { + "value": "Raid01 Stage01 Key Item" + }, + "/lotus/types/keys/raidkeys/raid01stage01nightmarekeyitem": { + "value": "Raid01 Stage01 Nightmare Key Item" + }, + "/lotus/types/keys/raidkeys/raid01stage02keyitem": { + "value": "Raid01 Stage02 Key Item" + }, + "/lotus/types/keys/raidkeys/raid01stage02nightmarekeyitem": { + "value": "Raid01 Stage02 Nightmare Key Item" + }, + "/lotus/types/keys/raidkeys/raid01stage03keyitem": { + "value": "Raid01 Stage03 Key Item" + }, + "/lotus/types/keys/raidkeys/raid01stage03nightmarekeyitem": { + "value": "Raid01 Stage03 Nightmare Key Item" + }, + "/lotus/types/keys/raidkeys/raidgolemstage01keyitem": { + "value": "Raid Golem Stage01 Key Item" + }, + "/lotus/types/keys/raidkeys/raidgolemstage02keyitem": { + "value": "Raid Golem Stage02 Key Item" + }, + "/lotus/types/keys/raidkeys/raidgolemstage03keyitem": { + "value": "Raid Golem Stage03 Key Item" + }, + "/lotus/types/keys/tacalertkeyanniversary2017a": { + "value": "Enemy forces have obtained information on some of the Lotus' artifacts. Stop them before they get away!\n\nYou may only use Secondary weapons on this mission." + }, + "/lotus/types/keys/tacalertkeyanniversary2017b": { + "value": "Enemy forces have obtained information on some of the Lotus' artifacts. Stop them before they get away!\n\nYou may only use Primary weapons on this mission." + }, + "/lotus/types/keys/tacalertkeyanniversary2017c": { + "value": "Enemy forces have obtained information on some of the Lotus' artifacts. Stop them before they get away!\n\nYou may only use Melee weapons on this mission.!" + }, + "/lotus/types/keys/tacalertkeyanniversary2018d": { + "value": "--" + }, + "/lotus/types/levelobjects/corpusbreakablevent": { + "value": "Corpus Breakable Vent" + }, + "/lotus/types/levelobjects/grineerbreakablefan": { + "value": "Grineer Breakable Fan" + }, + "/lotus/types/lore/lorefragmentscandeco": { + "value": "Lore Fragment Scan Deco" + }, + "/lotus/types/neutralcreatures/catbrow/catbrowavatar": { + "value": "Catbrow Avatar" + }, + "/lotus/types/neutralcreatures/creatureavatars/sandrayavatar": { + "value": "Sand Ray Avatar" + }, + "/lotus/types/neutralcreatures/kubrow/kubrowavatar": { + "value": "Kubrow Avatar" + }, + "/lotus/types/neutralcreatures/kubrow/kubrowden": { + "value": "Kubrow Den" + }, + "/lotus/types/pickups/basemediumlootcrate": { + "value": "Base Medium Loot Crate" + }, + "/lotus/types/pickups/derelictorokinlootcrate": { + "value": "Derelict Orokin Loot Crate" + }, + "/lotus/types/pickups/lootcontainers/corpuslootcratecommon": { + "value": "Corpus Loot Crate Common" + }, + "/lotus/types/pickups/lootcontainers/corpuslootcrateuncommon": { + "value": "Corpus Loot Crate Uncommon" + }, + "/lotus/types/pickups/mediumlootcrate": { + "value": "Medium Loot Crate" + }, + "/lotus/types/pickups/mediumlootcrategrna": { + "value": "Medium Loot Crate Grn A" + }, + "/lotus/types/pickups/mediumlootcrategrnb": { + "value": "Medium Loot Crate Grn B" + }, + "/lotus/types/pickups/mediumlootcrategrnforta": { + "value": "Medium Loot Crate Grn Fort A" + }, + "/lotus/types/pickups/mediumlootcrategrnfortb": { + "value": "Medium Loot Crate Grn Fort B" + }, + "/lotus/types/pickups/orokinlootcrate": { + "value": "Orokin Loot Crate" + }, + "/lotus/types/pickups/rarecorpuslootcrate": { + "value": "Rare Corpus Loot Crate" + }, + "/lotus/types/pickups/raregrineerlootcrate": { + "value": "Rare Grineer Loot Crate" + }, + "/lotus/types/pickups/resourcecontainers/alloyplatecontainer": { + "value": "Alloy Plate Container" + }, + "/lotus/types/pickups/resourcecontainers/circuitscontainer": { + "value": "Circuits Container" + }, + "/lotus/types/pickups/resourcecontainers/controlmodulecontainer": { + "value": "Control Module Container" + }, + "/lotus/types/pickups/resourcecontainers/ferritecontainer": { + "value": "Ferrite Container" + }, + "/lotus/types/pickups/resourcecontainers/nanosporescontainer": { + "value": "Nano Spores Container" + }, + "/lotus/types/pickups/resourcecontainers/neurodescontainer": { + "value": "Neurodes Container" + }, + "/lotus/types/pickups/resourcecontainers/orokincellcontainer": { + "value": "Orokin Cell Container" + }, + "/lotus/types/pickups/resourcecontainers/plastidscontainer": { + "value": "Plastids Container" + }, + "/lotus/types/pickups/resourcecontainers/polymerbundlecontainer": { + "value": "Polymer Bundle Container" + }, + "/lotus/types/pickups/resourcecontainers/rubedocontainer": { + "value": "Rubedo Container" + }, + "/lotus/types/pickups/resourcecontainers/salvagecontainer": { + "value": "Salvage Container" + }, + "/lotus/types/pickups/ultrararegrineerlootcrate": { + "value": "Ultra Rare Grineer Loot Crate" + }, + "/lotus/types/player/pvptennoavatar": { + "value": "Pvp Tenno Avatar" + }, + "/lotus/types/recipes/components/formablueprint": { + "value": "Forma Blueprint" + }, + "/lotus/types/recipes/components/orokincatalystblueprint": { + "value": "Orokin Catalyst Blueprint" + }, + "/lotus/types/recipes/components/orokinreactorblueprint": { + "value": "Orokin Reactor Blueprint" + }, + "/lotus/types/recipes/components/utilityunlockerblueprint": { + "value": "Exilus Adapter Blueprint" + }, + "/lotus/types/recipes/helmets/statlesslokialthelmetblueprint": { + "value": "Essence Loki Helmet Blueprint" + }, + "/lotus/types/recipes/helmets/statlessnyxalthelmetblueprint": { + "value": "Menticide Nyx Helmet Blueprint" + }, + "/lotus/types/recipes/helmets/statlessv2nyxalthelmetblueprint": { + "value": "Vespa Nyx Helmet Blueprint" + }, + "/lotus/types/recipes/helmets/v2animaalthelmetblueprint": { + "value": "Clisthert Equinox Helmet Blueprint" + }, + "/lotus/types/recipes/weapons/deravandalblueprint": { + "value": "Dera Vandal Blueprint" + }, + "/lotus/types/recipes/weapons/grineercombatknifeprint": { + "value": "Sheev Blueprint" + }, + "/lotus/types/recipes/weapons/grineercombatknifesortieblueprint": { + "value": "Sheev Blueprint" + }, + "/lotus/types/recipes/weapons/karakwraithblueprint": { + "value": "Karak Wraith Blueprint" + }, + "/lotus/types/recipes/weapons/latronwraithblueprint": { + "value": "Latron Wraith Blueprint" + }, + "/lotus/types/recipes/weapons/snipetronvandalblueprint": { + "value": "Snipetron Vandal Blueprint" + }, + "/lotus/types/recipes/weapons/strunwraithblueprint": { + "value": "Strun Wraith Blueprint" + }, + "/lotus/types/recipes/weapons/twinviperswraithblueprint": { + "value": "Wraith Twin Vipers Blueprint" + }, + "/lotus/types/recipes/weapons/weaponparts/deravandalbarrel": { + "value": "Dera Vandal Barrel" + }, + "/lotus/types/recipes/weapons/weaponparts/deravandalreceiver": { + "value": "Dera Vandal Receiver" + }, + "/lotus/types/recipes/weapons/weaponparts/deravandalstock": { + "value": "Dera Vandal Stock" + }, + "/lotus/types/recipes/weapons/weaponparts/grineercombatknifeblade": { + "value": "Sheev Blade" + }, + "/lotus/types/recipes/weapons/weaponparts/grineercombatknifehandle": { + "value": "Sheev Handle" + }, + "/lotus/types/recipes/weapons/weaponparts/grineercombatknifeheatsink": { + "value": "Sheev Heatsink" + }, + "/lotus/types/recipes/weapons/weaponparts/grineercombatknifehilt": { + "value": "Sheev Hilt" + }, + "/lotus/types/recipes/weapons/weaponparts/karakwraithbarrel": { + "value": "Karak Wraith Barrel" + }, + "/lotus/types/recipes/weapons/weaponparts/karakwraithreceiver": { + "value": "Karak Wraith Receiver" + }, + "/lotus/types/recipes/weapons/weaponparts/karakwraithstock": { + "value": "Karak Wraith Stock" + }, + "/lotus/types/recipes/weapons/weaponparts/latronwraithbarrel": { + "value": "Latron Wraith Barrel" + }, + "/lotus/types/recipes/weapons/weaponparts/latronwraithreceiver": { + "value": "Latron Wraith Receiver" + }, + "/lotus/types/recipes/weapons/weaponparts/latronwraithstock": { + "value": "Latron Wraith Stock" + }, + "/lotus/types/recipes/weapons/weaponparts/snipetronvandalbarrel": { + "value": "Snipetron Vandal Barrel" + }, + "/lotus/types/recipes/weapons/weaponparts/snipetronvandalreceiver": { + "value": "Snipetron Vandal Receiver" + }, + "/lotus/types/recipes/weapons/weaponparts/snipetronvandalstock": { + "value": "Snipetron Vandal Stock" + }, + "/lotus/types/recipes/weapons/weaponparts/strunwraithbarrel": { + "value": "Strun Wraith Barrel" + }, + "/lotus/types/recipes/weapons/weaponparts/strunwraithreceiver": { + "value": "Strun Wraith Receiver" + }, + "/lotus/types/recipes/weapons/weaponparts/strunwraithstock": { + "value": "Strun Wraith Stock" + }, + "/lotus/types/recipes/weapons/weaponparts/twinviperswraithbarrel": { + "value": "Wraith Twin Vipers Barrel" + }, + "/lotus/types/recipes/weapons/weaponparts/twinviperswraithlink": { + "value": "Wraith Twin Vipers Link" + }, + "/lotus/types/recipes/weapons/weaponparts/twinviperswraithreceiver": { + "value": "Wraith Twin Vipers Receiver" + }, + "/lotus/types/restoratives/deployables/lisetturretavatar": { + "value": "Liset Turret Avatar" + }, + "/lotus/types/sentinels/sentinelavatar": { + "value": "Sentinel Avatar" + }, + "/lotus/types/sentinels/sentinelpowersuits/arcdronepowersuit": { + "value": "Diriga" + }, + "/lotus/types/sentinels/sentinelpowersuits/carrierpowersuit": { + "value": "Carrier" + }, + "/lotus/types/sentinels/sentinelpowersuits/dethcubepowersuit": { + "value": "Deth Cube" + }, + "/lotus/types/sentinels/sentinelpowersuits/gubberpowersuit": { + "value": "Djinn" + }, + "/lotus/types/sentinels/sentinelpowersuits/meleepetpowersuit": { + "value": "Helios" + }, + "/lotus/types/sentinels/sentinelpowersuits/primecarrierpowersuit": { + "value": "Carrier Prime" + }, + "/lotus/types/sentinels/sentinelpowersuits/primeheliospowersuit": { + "value": "Helios Prime" + }, + "/lotus/types/sentinels/sentinelpowersuits/primewyrmpowersuit": { + "value": "Wyrm Prime" + }, + "/lotus/types/sentinels/sentinelpowersuits/prismashadepowersuit": { + "value": "Prisma Shade" + }, + "/lotus/types/sentinels/sentinelpowersuits/shadepowersuit": { + "value": "Shade" + }, + "/lotus/types/sentinels/sentinelpowersuits/tnsentinelcrosspowersuit": { + "value": "Artax" + }, + "/lotus/types/sentinels/sentinelpowersuits/wyrmpowersuit": { + "value": "Wyrm" + }, + "/lotus/types/sentinels/sentinelweapons/burstlaserpistol": { + "value": "Burst Laser Pistol" + }, + "/lotus/types/sentinels/sentinelweapons/deconstructorprime/primeheliosglaiveweapon": { + "value": "Deconstructor Prime" + }, + "/lotus/types/sentinels/sentinelweapons/dethmachinerifle": { + "value": "Deth Machine Rifle" + }, + "/lotus/types/sentinels/sentinelweapons/gremlin": { + "value": "Gremlin" + }, + "/lotus/types/sentinels/sentinelweapons/laserrifle": { + "value": "Laser Rifle" + }, + "/lotus/types/sentinels/sentinelweapons/primelaserrifle": { + "value": "Laser Rifle Prime" + }, + "/lotus/types/sentinels/sentinelweapons/primesentshotgun": { + "value": "Sweeper Prime" + }, + "/lotus/types/sentinels/sentinelweapons/prismaburstlaserpistol": { + "value": "Prisma Burst Laser" + }, + "/lotus/types/sentinels/sentinelweapons/sentbioweapon": { + "value": "Stinger" + }, + "/lotus/types/sentinels/sentinelweapons/sentelecrailgun": { + "value": "Vulklok" + }, + "/lotus/types/sentinels/sentinelweapons/sentglaiveweapon": { + "value": "Deconstructor" + }, + "/lotus/types/sentinels/sentinelweapons/sentshotgun": { + "value": "Sweeper" + }, + "/lotus/types/storeitems/avatarimages/avatarimagegrineerqueensved": { + "value": "Grineer Queens Avatar" + }, + "/lotus/types/storeitems/avatarimages/avatarimagehalloween2016a": { + "value": "Day of the Dead Avatar" + }, + "/lotus/types/storeitems/avatarimages/avatarimagehalloween2016b": { + "value": "Day of the Dead Avatar" + }, + "/lotus/types/storeitems/avatarimages/avatarimagehalloween2016c": { + "value": "Day of the Dead Avatar" + }, + "/lotus/types/storeitems/avatarimages/avatarimagehalloween2016d": { + "value": "Day of the Dead Avatar" + }, + "/lotus/types/storeitems/avatarimages/avatarimageitem1": { + "value": "Excalibur Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/avatarimageitem2": { + "value": "Volt Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/avatarimageitem3": { + "value": "Trinity Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/avatarimageitem4": { + "value": "Rhino Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/avatarimageitem5": { + "value": "Mag Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/avatarimageitem6": { + "value": "Ash Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/avatarimageitem7": { + "value": "Ember Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/avatarimageitem8": { + "value": "Loki Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/avatarimageitemfrostprime": { + "value": "Loki Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/avatarimagepack1": { + "value": "Profile Icon Pack 1" + }, + "/lotus/types/storeitems/avatarimages/avatarimagepack2": { + "value": "Profile Icon Pack 2" + }, + "/lotus/types/storeitems/avatarimages/avatarimageteshinved": { + "value": "Teshin Glyph" + }, + "/lotus/types/storeitems/avatarimages/avatarpackash": { + "value": "Ash Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackashlocust": { + "value": "Ash Locust Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackbanshee": { + "value": "Banshee Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackbansheechorus": { + "value": "Banshee Chorus Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackchroma": { + "value": "Chroma Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackchromaamaru": { + "value": "Chroma Amaru Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackember": { + "value": "Ember Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackemberbackdraft": { + "value": "Ember Backdraft Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackexcalibur": { + "value": "Excalibur Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackexcaliburmordred": { + "value": "Excalibur Mordred Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackexcaliburpendragon": { + "value": "Excalibur Pendragon Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackfrost": { + "value": "Frost Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackfrostprime": { + "value": "Frost Prime Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackfrostsquall": { + "value": "Frost Squall Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackgrineer": { + "value": "Grineer Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackgunslinger": { + "value": "Mesa Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacklimbo": { + "value": "Limbo Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacklimbograeae": { + "value": "Limbo Magrite Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackloki": { + "value": "Loki Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacklokienigma": { + "value": "Loki Enigma Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacklokiswindle": { + "value": "Loki Swindle Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackmag": { + "value": "Mag Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackmaggauss": { + "value": "Mag Gauss Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackmagprime": { + "value": "Mag Prime Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackmesacortes": { + "value": "Mesa Ovis Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackmirage": { + "value": "Mirage Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackmiragetravelin": { + "value": "Mirage Trivelin Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacknekros": { + "value": "Nekros Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacknekrosshroud": { + "value": "Nekros Shroud Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacknova": { + "value": "Nova Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacknovaquantum": { + "value": "Nova Quantum Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacknovaslipstream": { + "value": "Nova Slipstream Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacknyx": { + "value": "Nyx Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacknyxvespa": { + "value": "Nyx Vespa Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackoberon": { + "value": "Oberon Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackoberonmarkhor": { + "value": "Oberon Markhor Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackpirate": { + "value": "Hydroid Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackpirateketos": { + "value": "Hydroid Ketos Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackrhino": { + "value": "Rhino Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackrhinovanguard": { + "value": "Rhino Vanguard Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacksaryn": { + "value": "Saryn Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacksarynchlora": { + "value": "Saryn Chlora Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacksyndicate": { + "value": "Syndicate Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacktrapper": { + "value": "Vauban Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacktrappergambit": { + "value": "Vauban Gambit Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacktrappersoldier": { + "value": "Vauban Armistice Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacktrinity": { + "value": "Trinity Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpacktrinitymeridian": { + "value": "Trinity Meridian Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackvalkyr": { + "value": "Valkyr Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackvalkyrkara": { + "value": "Valkyr Kara Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackvolt": { + "value": "Volt Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackvoltpulse": { + "value": "Volt Pulse Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackzephyr": { + "value": "Zephyr Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/avatarpackzephyrtengu": { + "value": "Zephyr Tengu Profile Icon Pack" + }, + "/lotus/types/storeitems/avatarimages/imageashbright": { + "value": "Ash Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageashdark": { + "value": "Ash Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageashlocustbright": { + "value": "Ash Locust Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageashlocustdark": { + "value": "Ash Locust Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageashprimebright": { + "value": "Ash Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageashprimedark": { + "value": "Ash Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageashscorpionbright": { + "value": "Ash Scorpion Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageashscorpiondark": { + "value": "Ash Scorpion Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagebansheebright": { + "value": "Banshee Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagebansheechorusbright": { + "value": "Banshee Chorus Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagebansheechorusdark": { + "value": "Banshee Chorus Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagebansheedark": { + "value": "Banshee Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagebansheereverbbright": { + "value": "Banshee Reverb Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagebansheereverbdark": { + "value": "Banshee Reverb Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagechromaamarubright": { + "value": "Chroma Amaru Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagechromaamarudark": { + "value": "Chroma Amaru Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagechromabright": { + "value": "Chroma Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagechromadark": { + "value": "Chroma Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagechromadracbright": { + "value": "Chroma Drac Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagechromadracdark": { + "value": "Chroma Drac Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageemberbackdraftbright": { + "value": "Ember Backdraft Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageemberbackdraftdark": { + "value": "Ember Backdraft Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageemberbright": { + "value": "Ember Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageemberdark": { + "value": "Ember Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageemberpheonixbright": { + "value": "Phoenix Ember Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageemberpheonixdark": { + "value": "Phoenix Ember Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageemberprimebright": { + "value": "Ember Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageemberprimedark": { + "value": "Ember Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageexcaliburavalonbright": { + "value": "Excalibur Avalon Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageexcaliburavalondark": { + "value": "Excalibur Avalon Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageexcaliburbright": { + "value": "Excalibur Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageexcaliburdark": { + "value": "Excalibur Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageexcaliburmordredbright": { + "value": "Excalibur Mordred Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageexcaliburmordreddark": { + "value": "Excalibur Mordred Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageexcaliburpendragonbright": { + "value": "Excalibur Pendragon Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageexcaliburpendragondark": { + "value": "Excalibur Pendragon Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageexcaliburprimebright": { + "value": "Excalibur Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageexcaliburprimedark": { + "value": "Excalibur Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageexcaliburproto": { + "value": "Excalibur Proto-suit Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagefrostaurorabright": { + "value": "Frost Aurora Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagefrostauroradark": { + "value": "Frost Aurora Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagefrostbright": { + "value": "Frost Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagefrostdark": { + "value": "Frost Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagefrostprimebright": { + "value": "Frost Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagefrostprimedark": { + "value": "Frost Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagefrostsquallbright": { + "value": "Frost Squall Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagefrostsqualldark": { + "value": "Frost Squall Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagegraeaelimbobright": { + "value": "Limbo Magrite Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagegraeaelimbodark": { + "value": "Limbo Magrite Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagegrineerballista": { + "value": "Grineer Ballista Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagegrineercaptainvor": { + "value": "Captain Vor Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagegrineerkeladethaym": { + "value": "Kela De Thaym Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagegrineerlancer": { + "value": "Grineer Lancer Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagegrineerroller": { + "value": "Grineer Roller Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagegrineersargusruk": { + "value": "Sargas Ruk Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagegunslingeraltbright": { + "value": "Mesa Longhorn Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagegunslingeraltdark": { + "value": "Mesa Longhorn Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagegunslingerbright": { + "value": "Mesa Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagegunslingerdark": { + "value": "Mesa Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagelimboaristeasbright": { + "value": "Limbo Aristeas Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagelimboaristeasdark": { + "value": "Limbo Aristeas Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagelimbobright": { + "value": "Limbo Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagelimbodark": { + "value": "Limbo Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagelokibright": { + "value": "Loki Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagelokidark": { + "value": "Loki Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagelokienigmabright": { + "value": "Loki Enigma Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagelokienigmadark": { + "value": "Loki Enigma Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagelokiessencebright": { + "value": "Loki Essence Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagelokiessencedark": { + "value": "Loki Essence Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagelokiprimebright": { + "value": "Loki Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagelokiprimedark": { + "value": "Loki Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagelokiswindlebright": { + "value": "Loki Swindle Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagelokiswindledark": { + "value": "Loki Swindle Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagemagbright": { + "value": "Mag Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagemagcoilbright": { + "value": "Mag Coil Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagemagcoildark": { + "value": "Mag Coil Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagemagdark": { + "value": "Mag Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagemaggaussbright": { + "value": "Mag Gauss Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagemaggaussdark": { + "value": "Mag Gauss Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagemagprimebright": { + "value": "Mag Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagemagprimedark": { + "value": "Mag Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagemesacortesbright": { + "value": "Mesa Ovis Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagemesacortesdark": { + "value": "Mesa Ovis Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagemiragebright": { + "value": "Mirage Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagemiragedark": { + "value": "Mirage Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagemirageharlequinbright": { + "value": "Mirage Harlequin Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagemirageharlequindark": { + "value": "Mirage Harlequin Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenekrosaraknidbright": { + "value": "Nekros Raknis Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenekrosarakniddark": { + "value": "Nekros Raknis Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenekrosbright": { + "value": "Nekros Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenekrosdark": { + "value": "Nekros Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenekrosshroudbright": { + "value": "Nekros Shroud Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenekrosshrouddark": { + "value": "Nekros Shroud Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenovaaltbright": { + "value": "Nova Flux Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenovaaltdark": { + "value": "Nova Flux Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenovabright": { + "value": "Nova Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenovadark": { + "value": "Nova Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenovaprimebright": { + "value": "Nova Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenovaprimedark": { + "value": "Nova Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenovaquantumbright": { + "value": "Nova Quantum Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenovaquantumdark": { + "value": "Nova Quantum Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenovaslipstreambright": { + "value": "Nova Slipstream Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenovaslipstreamdark": { + "value": "Nova Slipstream Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenyxbright": { + "value": "Nyx Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenyxdark": { + "value": "Nyx Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenyxmenticidebright": { + "value": "Nyx Menticide Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenyxmenticidedark": { + "value": "Nyx Menticide Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenyxprimebright": { + "value": "Nyx Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenyxprimedark": { + "value": "Nyx Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenyxvespabright": { + "value": "Nyx Vespa Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagenyxvespadark": { + "value": "Nyx Vespa Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageoberonaltbright": { + "value": "Oberon Oryx Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageoberonaltdark": { + "value": "Oberon Oryx Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageoberonbright": { + "value": "Oberon Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageoberondark": { + "value": "Oberon Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageoberonmarkhorbright": { + "value": "Oberon Markhor Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imageoberonmarkhordark": { + "value": "Oberon Markhor Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagepiratebright": { + "value": "Hydroid Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagepiratedark": { + "value": "Hydroid Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagepirateketosbright": { + "value": "Hydroid Ketos Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagepirateketosdark": { + "value": "Hydroid Ketos Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagepiratetritonbright": { + "value": "Hydroid Triton Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagepiratetritondark": { + "value": "Hydroid Triton Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagerhinobright": { + "value": "Rhino Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagerhinodark": { + "value": "Rhino Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagerhinoprimebright": { + "value": "Rhino Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagerhinoprimedark": { + "value": "Rhino Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagerhinothrakbright": { + "value": "Rhino Thrak Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagerhinothrakdark": { + "value": "Rhino Thrak Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagerhinovanguardbright": { + "value": "Rhino Vanguard Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagerhinovanguarddark": { + "value": "Rhino Vanguard Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagesarynbright": { + "value": "Saryn Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagesarynchlorabright": { + "value": "Saryn Chlora Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagesarynchloradark": { + "value": "Saryn Chlora Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagesaryndark": { + "value": "Saryn Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagesarynhemlockbright": { + "value": "Saryn Hemlock Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagesarynhemlockdark": { + "value": "Saryn Hemlock Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagesyndicateah": { + "value": "Arbiters Of Hexis Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagesyndicatecs": { + "value": "Cephalon Suda Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagesyndicatenl": { + "value": "New Loka Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagesyndicateps": { + "value": "Perrin Sequence Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagesyndicaterv": { + "value": "Red Veil Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagesyndicatesm": { + "value": "Steel Meridian Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetrapperaltbright": { + "value": "Vauban Esprit Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetrapperaltdark": { + "value": "Vauban Esprit Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetrapperbright": { + "value": "Vauban Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetrapperdark": { + "value": "Vauban Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetrappergambitbright": { + "value": "Vauban Gambit Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetrappergambitdark": { + "value": "Vauban Gambit Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetrappersoldierbright": { + "value": "Vauban Armistice Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetrappersoldierdark": { + "value": "Vauban Armistice Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetravelinmiragebright": { + "value": "Mirage Trivelin Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetravelinmiragedark": { + "value": "Mirage Trivelin Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetrinityaurabright": { + "value": "Trinity Aura Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetrinityauradark": { + "value": "Trinity Aura Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetrinitybright": { + "value": "Trinity Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetrinitydark": { + "value": "Trinity Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetrinitymeridianbright": { + "value": "Trinity Meridian Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagetrinitymeridiandark": { + "value": "Trinity Meridian Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagevalkyrbastetbright": { + "value": "Valkyr Bastet Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagevalkyrbastetdark": { + "value": "Valkyr Bastet Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagevalkyrbright": { + "value": "Valkyr Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagevalkyrdark": { + "value": "Valkyr Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagevalkyrkarabright": { + "value": "Valkyr Kara Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagevalkyrkaradark": { + "value": "Valkyr Kara Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagevoltbright": { + "value": "Volt Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagevoltdark": { + "value": "Volt Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagevoltprimebright": { + "value": "Volt Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagevoltprimedark": { + "value": "Volt Prime Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagevoltpulsebright": { + "value": "Volt Pulse Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagevoltpulsedark": { + "value": "Volt Pulse Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagevoltstormbright": { + "value": "Volt Storm Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagevoltstormdark": { + "value": "Volt Storm Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagezephyrbright": { + "value": "Zephyr Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagezephyrcierzobright": { + "value": "Zephyr Cierzo Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagezephyrcierzodark": { + "value": "Zephyr Cierzo Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagezephyrdark": { + "value": "Zephyr Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagezephyrtengubright": { + "value": "Zephyr Tengu Profile Icon" + }, + "/lotus/types/storeitems/avatarimages/imagezephyrtengudark": { + "value": "Zephyr Tengu Profile Icon" + }, + "/lotus/types/storeitems/boosters/affinitybooster3daystoreitem": { + "value": "3 Day Affinity Booster" + }, + "/lotus/types/storeitems/boosters/affinityboosterstoreitem": { + "value": "Affinity Booster" + }, + "/lotus/types/storeitems/boosters/creditbooster3daystoreitem": { + "value": "3 Day Credit Booster" + }, + "/lotus/types/storeitems/boosters/creditboosterstoreitem": { + "value": "Credit Booster" + }, + "/lotus/types/storeitems/boosters/goodstuffdropchanceboosterstoreitem": { + "value": "Drop Chance Booster" + }, + "/lotus/types/storeitems/boosters/moddropchanceboosterstoreitem": { + "value": "Mod Drop Chance Booster" + }, + "/lotus/types/storeitems/boosters/resourceamount3daystoreitem": { + "value": "3 Day Resource (Amount) Booster" + }, + "/lotus/types/storeitems/boosters/resourceamountboosterstoreitem": { + "value": "Resource (Amount) Booster" + }, + "/lotus/types/storeitems/boosters/resourcedropchanceboosterstoreitem": { + "value": "Resource Drop Chance Booster" + }, + "/lotus/types/storeitems/boosters/reviveboosterstoreitem": { + "value": "Revive Booster" + }, + "/lotus/types/storeitems/consumables/restoratives/creditchiplargeblueprint": { + "value": "Passionate Void Offering" + }, + "/lotus/types/storeitems/consumables/restoratives/creditchipmediumblueprint": { + "value": "Faithful Void Offering" + }, + "/lotus/types/storeitems/creditbundles/creditbundlea": { + "value": "Frugal Credit Bundle" + }, + "/lotus/types/storeitems/creditbundles/creditbundleb": { + "value": "Prodigal Credit Bundle" + }, + "/lotus/types/storeitems/creditbundles/creditbundlec": { + "value": "High Roller Credit Bundle" + }, + "/lotus/types/storeitems/packages/acolytenogglebundle": { + "value": "Acolyte Noggle Pack" + }, + "/lotus/types/storeitems/packages/alternatearrowskinsbundle": { + "value": "Adventus Arrow Collection" + }, + "/lotus/types/storeitems/packages/antitoxinpack": { + "value": "Cicero Crisis Antidote Pack" + }, + "/lotus/types/storeitems/packages/ashdeluxeskinbundle": { + "value": "Koga Bundle" + }, + "/lotus/types/storeitems/packages/bansheedeluxeskinbundle": { + "value": "Banshee Soprana Bundle" + }, + "/lotus/types/storeitems/packages/bansheepack": { + "value": "Dead Silence Pack" + }, + "/lotus/types/storeitems/packages/bardbundle": { + "value": "Octavia Collection" + }, + "/lotus/types/storeitems/packages/berserkerpack": { + "value": "Berserker Bundle" + }, + "/lotus/types/storeitems/packages/boltorbundle": { + "value": "Ballistic Blades Bundle" + }, + "/lotus/types/storeitems/packages/brassandgoldbundle": { + "value": "Ormolu Skin Bundle" + }, + "/lotus/types/storeitems/packages/candycanescythepack": { + "value": "Spearmint Scythes" + }, + "/lotus/types/storeitems/packages/colorpack": { + "value": "Color Pack: Alpha" + }, + "/lotus/types/storeitems/packages/colorpackb": { + "value": "Color Pack: Beta" + }, + "/lotus/types/storeitems/packages/comicglyphsbundlea": { + "value": "Halftone Glyph Pack" + }, + "/lotus/types/storeitems/packages/consoletennogenabundle": { + "value": "TennoGen Mega Bundle" + }, + "/lotus/types/storeitems/packages/consumablespack": { + "value": "Survival Kit" + }, + "/lotus/types/storeitems/packages/corpusdazzlecamocestraskinpack": { + "value": "Shock Camo Cestra" + }, + "/lotus/types/storeitems/packages/corpusdazzlecamoskinpack": { + "value": "Shock Camo Pack" + }, + "/lotus/types/storeitems/packages/corpusdazzlecamosniperskinpack": { + "value": "Shock Camo Lanka" + }, + "/lotus/types/storeitems/packages/corpushigharmorbundle": { + "value": "Arca Armor Bundle" + }, + "/lotus/types/storeitems/packages/corpusweaponbundlea": { + "value": "Arca Bundle" + }, + "/lotus/types/storeitems/packages/crpcircarmorpack": { + "value": "Porta Armor Bundle" + }, + "/lotus/types/storeitems/packages/crpfncarmorpack": { + "value": "Dendra Armor Set" + }, + "/lotus/types/storeitems/packages/crpindextwoarmorpack": { + "value": "Quaro Armor Collection" + }, + "/lotus/types/storeitems/packages/crpindextwoitempack": { + "value": "Quaro Collection" + }, + "/lotus/types/storeitems/packages/defenseeventpack": { + "value": "Weekend Event Dethcube Deal" + }, + "/lotus/types/storeitems/packages/demolitionarchwingbundle": { + "value": "Elytron Ultimatum Bundle" + }, + "/lotus/types/storeitems/packages/djinndeluxearmorpack": { + "value": "Gazal Armor Pack" + }, + "/lotus/types/storeitems/packages/djinndeluxecompletebundle": { + "value": "Gazal Complete Collection" + }, + "/lotus/types/storeitems/packages/doubleaffinitypack": { + "value": "Double Affinity Weekend Pack" + }, + "/lotus/types/storeitems/packages/dragonpack": { + "value": "Dragon Bundle" + }, + "/lotus/types/storeitems/packages/electricpack": { + "value": "Volt Value Pack" + }, + "/lotus/types/storeitems/packages/excaliburxbonepack": { + "value": "Prestige Pack I - Exclusive" + }, + "/lotus/types/storeitems/packages/falseprofitaccessories": { + "value": "False Profit Accessories" + }, + "/lotus/types/storeitems/packages/falseprofiteventmodpack": { + "value": "False Profit Mod Pack" + }, + "/lotus/types/storeitems/packages/females2helmetpack": { + "value": "Female Helmet Pack" + }, + "/lotus/types/storeitems/packages/femalesuitpack": { + "value": "Female Warframe Pack" + }, + "/lotus/types/storeitems/packages/femalesuitpackb": { + "value": "Femme Fatale Pack" + }, + "/lotus/types/storeitems/packages/fomorianrevengemodpack": { + "value": "Eyes Of Blight Mod Pack" + }, + "/lotus/types/storeitems/packages/fomorianrevengeskinpack": { + "value": "Eyes Of Blight Skin Pack" + }, + "/lotus/types/storeitems/packages/frostdeluxeskinbundle": { + "value": "Frost Harka Bundle" + }, + "/lotus/types/storeitems/packages/frostpack": { + "value": "Stay Frosty Pack" + }, + "/lotus/types/storeitems/packages/glassbundle": { + "value": "Gara Collection" + }, + "/lotus/types/storeitems/packages/glyphsbundlea": { + "value": "Adau Glyph Pack" + }, + "/lotus/types/storeitems/packages/glyphsbundleb": { + "value": "Emblematic Glyph Pack" + }, + "/lotus/types/storeitems/packages/grineercamoskinpack": { + "value": "Grineer Desert Tactics Pack" + }, + "/lotus/types/storeitems/packages/grineerforestskinpack": { + "value": "Forest-camo Skin Pack" + }, + "/lotus/types/storeitems/packages/grineerpack": { + "value": "Grineer Assault" + }, + "/lotus/types/storeitems/packages/grineerturbinesarmorpack": { + "value": "Harkonar Armor Set" + }, + "/lotus/types/storeitems/packages/grineervharmourbundle": { + "value": "Maggor Armor Bundle" + }, + "/lotus/types/storeitems/packages/grineervhitemsbundle": { + "value": "Maggor Assault Pack" + }, + "/lotus/types/storeitems/packages/grnsealabeventweaponpack": { + "value": "Dera Vandal Vs. Karak Wraith" + }, + "/lotus/types/storeitems/packages/gunslingerbundle": { + "value": "Gunslinger Bundle" + }, + "/lotus/types/storeitems/packages/halloweencrpcircarmorpack": { + "value": "Day of the Dead Porta Armor Pack" + }, + "/lotus/types/storeitems/packages/halloweenglyphbundle": { + "value": "Day of the Dead Calavera Glyph Pack" + }, + "/lotus/types/storeitems/packages/halloweenlatoskinpack": { + "value": "Lato Day Of The Dead Skin" + }, + "/lotus/types/storeitems/packages/halloweenscarfbundle": { + "value": "Day of the Dead Threads" + }, + "/lotus/types/storeitems/packages/halloweenscarfbundleb": { + "value": "Day of the Dead Threads II" + }, + "/lotus/types/storeitems/packages/halloweenshipskinbundle": { + "value": "Day of the Dead Skin Rides" + }, + "/lotus/types/storeitems/packages/halloweenskinpack": { + "value": "Day Of The Dead Weapon Skin Pack" + }, + "/lotus/types/storeitems/packages/halloweenskinpackc": { + "value": "Day of the Dead Weapon Skin Pack III" + }, + "/lotus/types/storeitems/packages/halloweenskinpackd": { + "value": "Day of the Dead Weapon Skin Pack IV" + }, + "/lotus/types/storeitems/packages/halloweenskinpackii": { + "value": "Day Of The Dead Weapon Skin Pack II" + }, + "/lotus/types/storeitems/packages/halloweenvastoskinpack": { + "value": "Vasto Day Of The Dead Skin" + }, + "/lotus/types/storeitems/packages/holsterseriesonepack": { + "value": "Adi Holster Collection" + }, + "/lotus/types/storeitems/packages/huntertoolpack": { + "value": "Kinetic Siphon Trap" + }, + "/lotus/types/storeitems/packages/iceeventmodpack": { + "value": "Cryotic Mod Pack" + }, + "/lotus/types/storeitems/packages/immortalskinpack": { + "value": "Immortal Skin Bundle" + }, + "/lotus/types/storeitems/packages/indexteamanogglebundle": { + "value": "Anyocorp Claims Investigation Noggle Pack" + }, + "/lotus/types/storeitems/packages/indexteambnogglebundle": { + "value": "Anyocorp Investor Relations Noggle Pack" + }, + "/lotus/types/storeitems/packages/indexteamcnogglebundle": { + "value": "Anyocorp Reclamation Unit Pack" + }, + "/lotus/types/storeitems/packages/indexteamdnogglebundle": { + "value": "Anyocorp Trading Group Noggle Pack" + }, + "/lotus/types/storeitems/packages/infembolistarmourbundle": { + "value": "Embolist Armour Bundle" + }, + "/lotus/types/storeitems/packages/infembolistcompletebundle": { + "value": "Embolist Collection" + }, + "/lotus/types/storeitems/packages/infestedfinsarmorpack": { + "value": "Iliac Armor Bundle" + }, + "/lotus/types/storeitems/packages/infestedincursionsmodpack": { + "value": "Mutalist Incursions Mod Pack" + }, + "/lotus/types/storeitems/packages/jadepack": { + "value": "Nyx Pack" + }, + "/lotus/types/storeitems/packages/kavatcolorpackhyekka": { + "value": "Hyekka Kavat Gene-Masking Kit" + }, + "/lotus/types/storeitems/packages/kavatcolorpackkrest": { + "value": "Krest Kavat Gene-Masking Kit" + }, + "/lotus/types/storeitems/packages/kavatcolorpacknesyr": { + "value": "Nesyr Kavat Gene-Masking Kit" + }, + "/lotus/types/storeitems/packages/kavatcolorpacknexus": { + "value": "Nexus Gene-Masking Kit" + }, + "/lotus/types/storeitems/packages/kavatcolorpacksolstice": { + "value": "Winter Gene-Masking Kit" + }, + "/lotus/types/storeitems/packages/kavatcolorpackxmas": { + "value": "Argyl Gene-Masking Kit" + }, + "/lotus/types/storeitems/packages/kavatstarterkit": { + "value": "Kavat Starter Kit" + }, + "/lotus/types/storeitems/packages/kintsukuroiskinbundle": { + "value": "Kintsugi Weapon Skin Collection" + }, + "/lotus/types/storeitems/packages/kubrowbasecolorpack": { + "value": "Basic Gene-masking Kit" + }, + "/lotus/types/storeitems/packages/kubrowcolorpackbold": { + "value": "Doveran Gene-masking Kit" + }, + "/lotus/types/storeitems/packages/kubrowcolorpackcandycane": { + "value": "Nistlebrush Gene-masking Kit" + }, + "/lotus/types/storeitems/packages/kubrowcolorpackdiamond": { + "value": "Atrox Gene-masking Kit" + }, + "/lotus/types/storeitems/packages/kubrowcolorpackliquid": { + "value": "Arklut Gene-masking Kit" + }, + "/lotus/types/storeitems/packages/kubrowcolorpacklotus": { + "value": "Averal Gene-masking Kit" + }, + "/lotus/types/storeitems/packages/kubrowcolorpacknexus": { + "value": "Nexus Gene-masking Kit" + }, + "/lotus/types/storeitems/packages/kubrowcolorpackreindeer": { + "value": "Nart-deer Gene-masking Kit" + }, + "/lotus/types/storeitems/packages/kubrowcolorpacksolstice": { + "value": "Solstice Gene-Masking Kit" + }, + "/lotus/types/storeitems/packages/kubrowcolorpackspeckled": { + "value": "Telmatian Gene-masking Kit" + }, + "/lotus/types/storeitems/packages/kubrowcolorpackstriped": { + "value": "Savenga Gene-masking Kit" + }, + "/lotus/types/storeitems/packages/kubrowcolorpacktiger": { + "value": "Tigrol Gene-masking Kit" + }, + "/lotus/types/storeitems/packages/kubrowstarterkit": { + "value": "Kubrow Starter Kit" + }, + "/lotus/types/storeitems/packages/kuvaarmorpack": { + "value": "Kuva Armor Pack" + }, + "/lotus/types/storeitems/packages/kuvamegabundle": { + "value": "Continuity Complete Collection" + }, + "/lotus/types/storeitems/packages/lightningsheathpack": { + "value": "Gemini Nikana Sheath" + }, + "/lotus/types/storeitems/packages/lokipack": { + "value": "Loki Pack" + }, + "/lotus/types/storeitems/packages/lunaroarmorcpack": { + "value": "Riv Elite-Guard Armor Pack" + }, + "/lotus/types/storeitems/packages/magdeluxeskinbundle": { + "value": "Mag Pneuma Collection" + }, + "/lotus/types/storeitems/packages/males2helmetpack": { + "value": "Male Helmet Pack" + }, + "/lotus/types/storeitems/packages/mashedglyphbundle": { + "value": "Mashed Glyph Pack" + }, + "/lotus/types/storeitems/packages/meleedanglepack": { + "value": "Sugatra Pack" + }, + "/lotus/types/storeitems/packages/memeglyphbundlea": { + "value": "Memetica Glyph Pack" + }, + "/lotus/types/storeitems/packages/mesadeluxeskinbundle": { + "value": "Mesa Presidio Collection" + }, + "/lotus/types/storeitems/packages/nemesisnyxbundle": { + "value": "Nemesis Complete Bundle" + }, + "/lotus/types/storeitems/packages/nidusbundle": { + "value": "Nidus Collection" + }, + "/lotus/types/storeitems/packages/nightwatchweaponskinbundle": { + "value": "Nightwatch Skin Bundle" + }, + "/lotus/types/storeitems/packages/novadeluxeskinbundle": { + "value": "Nova Asuri Bundle" + }, + "/lotus/types/storeitems/packages/oberondeluxeskinbundle": { + "value": "Oberon Feyarch Bundle" + }, + "/lotus/types/storeitems/packages/operatorarmourbundlemage": { + "value": "Vahd Armor Bundle" + }, + "/lotus/types/storeitems/packages/operatorarmourbundlemonk": { + "value": "Ceno Armor Bundle" + }, + "/lotus/types/storeitems/packages/operatorarmourbundleseer": { + "value": "Zauba Armor Bundle" + }, + "/lotus/types/storeitems/packages/operatorsuitdbundle": { + "value": "Manduka Operator Suit Bundle" + }, + "/lotus/types/storeitems/packages/operatorsuitsbundle": { + "value": "Operator Suit Bundle" + }, + "/lotus/types/storeitems/packages/orbiterdisplaybundle": { + "value": "Display Pack" + }, + "/lotus/types/storeitems/packages/ornateweaponbundle": { + "value": "Tekelu Weapon Bundle" + }, + "/lotus/types/storeitems/packages/orokinsabotagemodpack": { + "value": "Gate Crash Mod Pack" + }, + "/lotus/types/storeitems/packages/ostronshipdecopacka": { + "value": "Reclamator Pack" + }, + "/lotus/types/storeitems/packages/ostronshipdecopackb": { + "value": "Artisan Pack" + }, + "/lotus/types/storeitems/packages/paladindeluxeskinbundle": { + "value": "Oberon Feyarch Bundle" + }, + "/lotus/types/storeitems/packages/paladinpack": { + "value": "Paladin Bundle" + }, + "/lotus/types/storeitems/packages/parisweaponbundle": { + "value": "Forged Artistry Weapon Pack" + }, + "/lotus/types/storeitems/packages/petattachmentspacka": { + "value": "Sentinel Accessory Pack" + }, + "/lotus/types/storeitems/packages/petattachmentspackb": { + "value": "Sentinel Accessory Pack2" + }, + "/lotus/types/storeitems/packages/petattachmentspackcoltek": { + "value": "Coltek Sentinel Pack" + }, + "/lotus/types/storeitems/packages/petattachmentspackictus": { + "value": "Ictus Sentinel Pack" + }, + "/lotus/types/storeitems/packages/piratepack": { + "value": "Update 13 Mega Pack" + }, + "/lotus/types/storeitems/packages/pistolpack": { + "value": "Pistoleer Special" + }, + "/lotus/types/storeitems/packages/prestigepackseven": { + "value": "Prestige Pack VII" + }, + "/lotus/types/storeitems/packages/prestigepacksix": { + "value": "XB1 Prestige Pack VI" + }, + "/lotus/types/storeitems/packages/prestigepacktwo": { + "value": "Prestige Pack II" + }, + "/lotus/types/storeitems/packages/priestbundle": { + "value": "Harrow Collection" + }, + "/lotus/types/storeitems/packages/primeaccess2storeitem": { + "value": "Saryn Prime Access Pack" + }, + "/lotus/types/storeitems/packages/primeaccessory2storeitem": { + "value": "Saryn Prime Accessories Pack" + }, + "/lotus/types/storeitems/packages/primeaccessorystoreitem": { + "value": "Vauban Prime Accessories Pack" + }, + "/lotus/types/storeitems/packages/primeaccessstoreitem": { + "value": "Prime Access Pack" + }, + "/lotus/types/storeitems/packages/primevaultc": { + "value": "Prime Unvaulted: Fire & Ice Packs" + }, + "/lotus/types/storeitems/packages/prismaexcaliburpack": { + "value": "Prisma Excalibur Bundle" + }, + "/lotus/types/storeitems/packages/rhinowreckpack": { + "value": "Wrecking Rhino Pack" + }, + "/lotus/types/storeitems/packages/sanctuaryinitiationkit": { + "value": "Sanctuary Initiation Kit" + }, + "/lotus/types/storeitems/packages/sandmanbundle": { + "value": "Inaros Bundle" + }, + "/lotus/types/storeitems/packages/sarynpack": { + "value": "Poisonous Attitude Pack" + }, + "/lotus/types/storeitems/packages/setonearmorpack": { + "value": "Eos Armor Bundle" + }, + "/lotus/types/storeitems/packages/setthreearmorpack": { + "value": "Daedalus Armor Bundle" + }, + "/lotus/types/storeitems/packages/settwoarmorpack": { + "value": "Edo Armor Bundle" + }, + "/lotus/types/storeitems/packages/solsticesetthreearmorpack": { + "value": "Solstice Daedalus Armor Bundle" + }, + "/lotus/types/storeitems/packages/stalkerpack": { + "value": "What Stalker?" + }, + "/lotus/types/storeitems/packages/stalkertwobundle": { + "value": "Hunhow`s Gift Pack" + }, + "/lotus/types/storeitems/packages/starryskinbundle": { + "value": "Nocturne Weapon Skin Bundle" + }, + "/lotus/types/storeitems/packages/stealtharchwingbundle": { + "value": "Itzal Raider Pack" + }, + "/lotus/types/storeitems/packages/stealthpack": { + "value": "Stealth Pack" + }, + "/lotus/types/storeitems/packages/superchargepack": { + "value": "Super Charge Pack" + }, + "/lotus/types/storeitems/packages/supremesomabundle": { + "value": "Supreme Soma Set" + }, + "/lotus/types/storeitems/packages/tengupack": { + "value": "Update 12 Mega Bundle" + }, + "/lotus/types/storeitems/packages/tennosaisbundle": { + "value": "Okina Weapon Bundle" + }, + "/lotus/types/storeitems/packages/threedayaffinitypack": { + "value": "3 Day Affinity Booster" + }, + "/lotus/types/storeitems/packages/threedaycreditpack": { + "value": "3 Day Credit Booster" + }, + "/lotus/types/storeitems/packages/threedayresourcepack": { + "value": "3 Day Resource Booster" + }, + "/lotus/types/storeitems/packages/tigrisredeemersetpack": { + "value": "Razor Gunplay Bundle" + }, + "/lotus/types/storeitems/packages/titaniabundle": { + "value": "Silver Grove Bundle" + }, + "/lotus/types/storeitems/packages/tnguandaobundle": { + "value": "Guandao Collection" + }, + "/lotus/types/storeitems/packages/tnhvarmourbundle": { + "value": "Syrinx Armor Bundle" + }, + "/lotus/types/storeitems/packages/tnhvitemsbundle": { + "value": "Baza Collection" + }, + "/lotus/types/storeitems/packages/translatorpack": { + "value": "Dead Silence Pack" + }, + "/lotus/types/storeitems/packages/translatorpacktwo": { + "value": "Dead Silence Pack" + }, + "/lotus/types/storeitems/packages/trinitydeluxeskinbundle": { + "value": "Trinity Strega Bundle" + }, + "/lotus/types/storeitems/packages/twitchprimestoreitem": { + "value": "Free Prime with Twitch Prime" + }, + "/lotus/types/storeitems/packages/update10megapack": { + "value": "Update 10 Mega Bundle" + }, + "/lotus/types/storeitems/packages/update12cosmeticpack": { + "value": "U12 Cosmetic Pack" + }, + "/lotus/types/storeitems/packages/update14megapack": { + "value": "Mirage Bundle" + }, + "/lotus/types/storeitems/packages/update15bundle": { + "value": "Limbo Bundle" + }, + "/lotus/types/storeitems/packages/urubundle": { + "value": "Uru Templar Bundle" + }, + "/lotus/types/storeitems/packages/vaultraiderpack": { + "value": "Vault Raider Package" + }, + "/lotus/types/storeitems/packages/voidskinpack": { + "value": "[Placeholder]" + }, + "/lotus/types/storeitems/packages/vteosarmourbundle": { + "value": "Eos Prime Armor Set" + }, + "/lotus/types/storeitems/packages/vulkardealpack": { + "value": "Vulkar Deal Pack" + }, + "/lotus/types/storeitems/packages/warframepack": { + "value": "Ultimate Warframe Pack" + }, + "/lotus/types/storeitems/packages/weaponskincontestbundle": { + "value": "Tennogen Weapon Skin Bundle" + }, + "/lotus/types/storeitems/packages/winter2016bundle": { + "value": "Winter Solstice Skin Bundle" + }, + "/lotus/types/storeitems/packages/winteraccessoriesbundle": { + "value": "Winter Accessories Bundle" + }, + "/lotus/types/storeitems/packages/winterbundle": { + "value": "Winter Bundle" + }, + "/lotus/types/storeitems/packages/winterglyphbundle": { + "value": "Solstice Glyph Pack" + }, + "/lotus/types/storeitems/packages/winterglyphbundleb": { + "value": "Winter Glyph Pack" + }, + "/lotus/types/storeitems/slotitems/kubrowslotitem": { + "value": "Stasis Slot" + }, + "/lotus/types/storeitems/slotitems/suitslotitem": { + "value": "Warframe Slot" + }, + "/lotus/types/storeitems/slotitems/weaponslotitem": { + "value": "Weapon Slot" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickerbastilleitem": { + "value": "Bastille" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickerdaybreakitema": { + "value": "Daybreak" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickerdefaultsitema": { + "value": "Tenno" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickereasteritema": { + "value": "Easter" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickereximus": { + "value": "Eximus" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickerfireitema": { + "value": "Fire" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickergammaitema": { + "value": "Gamma" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickergrineeritema": { + "value": "Grineer" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickerhalloweenitema": { + "value": "Halloween" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickericeitema": { + "value": "Ice" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickerinfesteditema": { + "value": "Infested" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickeritem": { + "value": "Classic" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickeritemb": { + "value": "Classic Saturated" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickeritemc": { + "value": "Storm" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickeritemd": { + "value": "Color Picker D" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickerlotus": { + "value": "Lotus" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickerorokin": { + "value": "Orokin" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickerps4itema": { + "value": "Psiv" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickerrwbitem": { + "value": "Red/white/blue" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickershamrockitem": { + "value": "Shamrock" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickertwilightitema": { + "value": "Twilight" + }, + "/lotus/types/storeitems/suitcustomizations/colourpickervalitema": { + "value": "Valentine" + }, + "/lotus/types/storeitems/suitcustomizations/ninjacolourpickeritem": { + "value": "Smoke Colors" + }, + "/lotus/upgrades/mods/aura/infestationspeedreductionauramod": { + "value": "Infested Impedance" + }, + "/lotus/upgrades/mods/aura/playerlootradarauramod": { + "value": "Loot Radar" + }, + "/lotus/upgrades/mods/fusionbundles/alertfusionbundlelarge": { + "value": "150 Endo" + }, + "/lotus/upgrades/mods/fusionbundles/alertfusionbundlemedium": { + "value": "100 Endo" + }, + "/lotus/upgrades/mods/fusionbundles/alertfusionbundlesmall": { + "value": "80 Endo" + }, + "/lotus/upgrades/mods/pvpmods/warframe/morehealthlessbulletjumpmod": { + "value": "More Health Less Bullet Jump Mod" + }, + "/lotus/upgrades/skins/antimatter/novaalternateskin": { + "value": "Nova Immortal Skin" + }, + "/lotus/upgrades/skins/antimatter/novadeluxesuit": { + "value": "Nova Asuri Skin" + }, + "/lotus/upgrades/skins/archer/wintersolsticesalix": { + "value": "Solstice Salix Syandana" + }, + "/lotus/upgrades/skins/armor/crpcirclearmour/halloweencrpcirca": { + "value": "Day of the Dead Porta Armor" + }, + "/lotus/upgrades/skins/armor/crpcirclearmour/halloweencrpcircc": { + "value": "Day of the Dead Porta Chest Armor" + }, + "/lotus/upgrades/skins/armor/crpcirclearmour/halloweencrpcircl": { + "value": "Day of the Dead Porta Leg Plates" + }, + "/lotus/upgrades/skins/armor/halloween2014wings/halloween2014armarmor": { + "value": "Naeberus Wings" + }, + "/lotus/upgrades/skins/armor/setthreewinged/solsticesetthreearmarmor": { + "value": "Solstice Daedalus Shoulder Plates" + }, + "/lotus/upgrades/skins/armor/setthreewinged/solsticesetthreechestarmor": { + "value": "Solstice Daedalus Chest Plate" + }, + "/lotus/upgrades/skins/armor/setthreewinged/solsticesetthreelegarmor": { + "value": "Solstice Daedalus Knee Plates" + }, + "/lotus/upgrades/skins/armor/settwosamurai/settwochestarmor": { + "value": "Set Two Chest Armor" + }, + "/lotus/upgrades/skins/armor/warframedefaults/frostdeluxearmarmor": { + "value": "Frost Deluxe Arm Armor" + }, + "/lotus/upgrades/skins/armor/warframedefaults/frostprimearmarmor": { + "value": "Frost Prime Arm Armor" + }, + "/lotus/upgrades/skins/asp/sarynalternateskin": { + "value": "Saryn Immortal Skin" + }, + "/lotus/upgrades/skins/berserker/berserkerdeluxesuit": { + "value": "Valkyr Gersemi Skin" + }, + "/lotus/upgrades/skins/berserker/valkyralternateskin": { + "value": "Valkyr Immortal Skin" + }, + "/lotus/upgrades/skins/catbrows/armor/catbrowarmorc": { + "value": "Myrdin Kavat Armor" + }, + "/lotus/upgrades/skins/catbrows/armor/grnqueencatbrowarmor": { + "value": "Kuva Kavat Armor" + }, + "/lotus/upgrades/skins/clan/shipyardseventquantumbadgeitem": { + "value": "Shipyards Event Quantum Badge Item" + }, + "/lotus/upgrades/skins/cowgirl/mesadeluxeskin": { + "value": "Mesa Presidio Skin" + }, + "/lotus/upgrades/skins/decree/bansheealternateskin": { + "value": "Banshee Immortal Skin" + }, + "/lotus/upgrades/skins/decree/bansheedeluxesuit": { + "value": "Banshee Soprana Skin" + }, + "/lotus/upgrades/skins/dragon/chromadeluxeskin": { + "value": "Chroma Dynasty Skin" + }, + "/lotus/upgrades/skins/ember/emberalternateskin": { + "value": "Ember Immortal Skin" + }, + "/lotus/upgrades/skins/excalibur/excaliburalternateskin": { + "value": "Excalibur Immortal Skin" + }, + "/lotus/upgrades/skins/excalibur/excaliburprotosuit": { + "value": "Excalibur Protoskin" + }, + "/lotus/upgrades/skins/fairy/fairyalthelmet": { + "value": "Titania Aurai Helmet" + }, + "/lotus/upgrades/skins/fairy/solsticefairyskin": { + "value": "Titania Solstice Skin" + }, + "/lotus/upgrades/skins/festivities/jingleknuckles": { + "value": "Ringers" + }, + "/lotus/upgrades/skins/festivities/pumpkinhead": { + "value": "Dullahan Mask" + }, + "/lotus/upgrades/skins/festivities/xmasglaxion": { + "value": "Festive Glaxion Skin" + }, + "/lotus/upgrades/skins/festivities/xmassonicor": { + "value": "Festive Sonicor Skin" + }, + "/lotus/upgrades/skins/frost/frostalternateskin": { + "value": "Frost Immortal Skin" + }, + "/lotus/upgrades/skins/frost/frostdeluxehelmet": { + "value": "Frost Deluxe Helmet" + }, + "/lotus/upgrades/skins/frost/frostdeluxesuit": { + "value": "Frost Harka Skin" + }, + "/lotus/upgrades/skins/frost/frostnobleanims": { + "value": "Frost Noble Anims" + }, + "/lotus/upgrades/skins/frost/frostxmasskin": { + "value": "Festive Frost Skin" + }, + "/lotus/upgrades/skins/frost/swrfourfrostjotunhelmet": { + "value": "S W R Four Frost Jotun Helmet" + }, + "/lotus/upgrades/skins/frost/swrthreefrostgrostskin": { + "value": "S W R Three Frost Grost Skin" + }, + "/lotus/upgrades/skins/frost/swrthreefrostzastrugahelmet": { + "value": "S W R Three Frost Zastruga Helmet" + }, + "/lotus/upgrades/skins/glass/glassalthelmet": { + "value": "Gara Virago Helmet" + }, + "/lotus/upgrades/skins/halloween/halloweenaklato": { + "value": "Day of the Dead AkLato Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenamprex": { + "value": "Day of the Dead Amprex Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenangstrum": { + "value": "Day of the Dead Angstrum Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenarchsword": { + "value": "Day of the Dead Veritux Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenboltor": { + "value": "Day of the Dead Boltor Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenbraton": { + "value": "Day of the Dead Braton Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenbuzlok": { + "value": "Day of the Dead Buzlok Skin" + }, + "/lotus/upgrades/skins/halloween/halloweendaikyu": { + "value": "Day of the Dead Daiku Skin Skin" + }, + "/lotus/upgrades/skins/halloween/halloweendarkdagger": { + "value": "Day of the Dead Dark Dagger" + }, + "/lotus/upgrades/skins/halloween/halloweendarksplitsword": { + "value": "Day of the Dead Dark Split Sword Skin" + }, + "/lotus/upgrades/skins/halloween/halloweendragonnikana": { + "value": "Day of the Dead Dragon Nikana Skin" + }, + "/lotus/upgrades/skins/halloween/halloweendualzoren": { + "value": "Day of the Dead Dual Zoren Skin" + }, + "/lotus/upgrades/skins/halloween/halloweengalatine": { + "value": "Day of the Dead Galatine Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenglaive": { + "value": "Day of the Dead Glaive Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenglaxion": { + "value": "Day of the Dead Glaxion Skin" + }, + "/lotus/upgrades/skins/halloween/halloweengorgon": { + "value": "Day of the Dead Gorgon Skin" + }, + "/lotus/upgrades/skins/halloween/halloweengrakata": { + "value": "Day of the Dead Grakata" + }, + "/lotus/upgrades/skins/halloween/halloweengrinlok": { + "value": "Day of the Dead Grinlok Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenimperator": { + "value": "Day of the Dead Imperator Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenjatkittag": { + "value": "Day of the Dead Jat Kittag Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenkronen": { + "value": "Day of the Dead Kronen Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenkunai": { + "value": "Day of the Dead Kunai Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenlato": { + "value": "Day of the Dead Lato Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenmarelok": { + "value": "Day of the Dead Marelok Skin" + }, + "/lotus/upgrades/skins/halloween/halloweennikana": { + "value": "Day of the Dead Nikana Skin" + }, + "/lotus/upgrades/skins/halloween/halloweennukor": { + "value": "Day of the Dead Nukor Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenopticor": { + "value": "Day of the Dead Opticor Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenorthos": { + "value": "Day of the Dead Orthos Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenparis": { + "value": "Day of the Dead Paris Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenregoraxeshield": { + "value": "Day of the Dead Ack & Brunt Skin" + }, + "/lotus/upgrades/skins/halloween/halloweensarpa": { + "value": "Day of the Dead Sarpa" + }, + "/lotus/upgrades/skins/halloween/halloweenscindo": { + "value": "Day of the Dead Scindo Skin" + }, + "/lotus/upgrades/skins/halloween/halloweensilvaandaegis": { + "value": "Day of the Dead Silva & Aegis Skin" + }, + "/lotus/upgrades/skins/halloween/halloweensimulor": { + "value": "Day of the Dead Simulor" + }, + "/lotus/upgrades/skins/halloween/halloweenskana": { + "value": "Day of the Dead Skana Skin" + }, + "/lotus/upgrades/skins/halloween/halloweensobek": { + "value": "Day of the Dead Sobek Skin" + }, + "/lotus/upgrades/skins/halloween/halloweensoma": { + "value": "Day of the Dead Soma Skin" + }, + "/lotus/upgrades/skins/halloween/halloweensonicor": { + "value": "Day of the Dead Sarpa" + }, + "/lotus/upgrades/skins/halloween/halloweenspira": { + "value": "Day of the Dead Spira Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenstradavar": { + "value": "Day of the Dead Stradavar" + }, + "/lotus/upgrades/skins/halloween/halloweentonkor": { + "value": "Day of the Dead Tonkor" + }, + "/lotus/upgrades/skins/halloween/halloweentwingrakatas": { + "value": "Day of the Dead Twin Grakata Skin" + }, + "/lotus/upgrades/skins/halloween/halloweentwingremlins": { + "value": "Day of the Dead Twin Gremlins Skin" + }, + "/lotus/upgrades/skins/halloween/halloweenvasto": { + "value": "Day of the Dead Vasto Skin" + }, + "/lotus/upgrades/skins/hammer/solsticeheliocor": { + "value": "Heliocor Solstice Skin" + }, + "/lotus/upgrades/skins/harlequin/miragexmasskin": { + "value": "Mirage Winter Skin" + }, + "/lotus/upgrades/skins/holstercustomizations/heavyupperback": { + "value": "Heavy Upper Back" + }, + "/lotus/upgrades/skins/holstercustomizations/pistolhipsdual": { + "value": "Pistol Hips Dual" + }, + "/lotus/upgrades/skins/holstercustomizations/rifleupperback": { + "value": "Rifle Upper Back" + }, + "/lotus/upgrades/skins/jade/nyxalternateskin": { + "value": "Nyx Immortal Skin" + }, + "/lotus/upgrades/skins/jade/nyxnemesissuit": { + "value": "Nyx Nemesis Skin" + }, + "/lotus/upgrades/skins/kubrows/armor/grineerqueenarmor": { + "value": "Kuva Armor Collection" + }, + "/lotus/upgrades/skins/kubrows/collars/kubrowcollarxmas": { + "value": "Little Helper Hat" + }, + "/lotus/upgrades/skins/liset/gyroscope/lisetgyroscopegrineerqueens": { + "value": "Kuva Xiphos Skin" + }, + "/lotus/upgrades/skins/liset/gyroscope/lisetgyroscopeskinifrit": { + "value": "Xiphos Ifrit Skin" + }, + "/lotus/upgrades/skins/liset/gyroscope/lisetgyroscopeskinnekrognos": { + "value": "Xiphos Henipa Skin" + }, + "/lotus/upgrades/skins/liset/lisetblueskyskingrineerqueens": { + "value": "Kuva Scimitar Skin" + }, + "/lotus/upgrades/skins/liset/lisetinsectskingrineerqueens": { + "value": "Kuva Mantis Skin" + }, + "/lotus/upgrades/skins/liset/lisetinsectskinhalloween": { + "value": "Day of the Dead Mantis Skin" + }, + "/lotus/upgrades/skins/liset/lisetskingrineerqueens": { + "value": "Kuva Liset Skin" + }, + "/lotus/upgrades/skins/liset/lisetskinhalloween": { + "value": "Day of the Dead Liset Skin" + }, + "/lotus/upgrades/skins/loki/lokialternateskin": { + "value": "Loki Immortal Skin" + }, + "/lotus/upgrades/skins/loki/lokideluxesuit": { + "value": "Loki Knave Skin" + }, + "/lotus/upgrades/skins/lunaro/arcataskina": { + "value": "Arcata Riv Skin" + }, + "/lotus/upgrades/skins/mag/magalternateskin": { + "value": "Mag Immortal Skin" + }, + "/lotus/upgrades/skins/meleedangles/esgrnsugatrameleedangle": { + "value": "Boloket Sugatra" + }, + "/lotus/upgrades/skins/meleedangles/grnqueensmeleedangle": { + "value": "Kuva Braid" + }, + "/lotus/upgrades/skins/monkeyking/monkeykingalthelmetb": { + "value": "Wukong Macak Helmet" + }, + "/lotus/upgrades/skins/necro/nekrosalternateskin": { + "value": "Nekros Immortal Skin" + }, + "/lotus/upgrades/skins/ninja/ashalternateskin": { + "value": "Ash Immortal Skin" + }, + "/lotus/upgrades/skins/nezha/nezhaalt2helmet": { + "value": "Nezha Jinza Helmet" + }, + "/lotus/upgrades/skins/ninja/ninjadeluxesuit": { + "value": "Koga Ash Skin" + }, + "/lotus/upgrades/skins/operator/accessories/baromouthpiecea": { + "value": "Baro Mouth Piece A" + }, + "/lotus/upgrades/skins/operator/bodies/femalebody": { + "value": "Female Body" + }, + "/lotus/upgrades/skins/operator/bodysuits/nobodysuit": { + "value": "No Body Suit" + }, + "/lotus/upgrades/skins/operator/facialmarkings/facialmarkingd": { + "value": "Facial Marking D" + }, + "/lotus/upgrades/skins/operator/hair/hairj": { + "value": "Hair J" + }, + "/lotus/upgrades/skins/operator/heads/femaleheadc": { + "value": "Female Head C" + }, + "/lotus/upgrades/skins/operator/heads/femaleheadj": { + "value": "Female Head J" + }, + "/lotus/upgrades/skins/operator/hoods/nohood": { + "value": "No Hood" + }, + "/lotus/upgrades/skins/operator/leggings/noleggings": { + "value": "No Leggings" + }, + "/lotus/upgrades/skins/operator/skirts/hipsocketb": { + "value": "Operator Hip Socket Bundle" + }, + "/lotus/upgrades/skins/operator/skirts/noskirt": { + "value": "No Skirt" + }, + "/lotus/upgrades/skins/operator/sleeves/nosleeves": { + "value": "No Sleeves" + }, + "/lotus/upgrades/skins/paladin/oberonalternateskin": { + "value": "Oberon Immortal Skin" + }, + "/lotus/upgrades/skins/paladin/paladindeluxesuit": { + "value": "Oberon Feyarch Skin" + }, + "/lotus/upgrades/skins/promo/seasonal/candycanescytheskin": { + "value": "Spearmint Scythe" + }, + "/lotus/upgrades/skins/ranger/rangeralt02helmet": { + "value": "Ivara Zirastra Helmet" + }, + "/lotus/upgrades/skins/rhino/rhinoalternateskin": { + "value": "Rhino Immortal Skin" + }, + "/lotus/upgrades/skins/rhino/rhinodeluxesuit": { + "value": "Rhino Palatine Skin" + }, + "/lotus/upgrades/skins/sandman/sandmanalt02helmet": { + "value": "Inaros Canopic Helmet" + }, + "/lotus/upgrades/skins/saryn/saryndeluxesuit": { + "value": "Saryn Orphid Skin" + }, + "/lotus/upgrades/skins/scarves/april2015scarf": { + "value": "Kyroptera Syandana" + }, + "/lotus/upgrades/skins/scarves/energyscarf": { + "value": "Asa Syandana" + }, + "/lotus/upgrades/skins/scarves/flamescarf": { + "value": "Pyra Synadana" + }, + "/lotus/upgrades/skins/scarves/grnqueenscarf": { + "value": "Kuva Cloak" + }, + "/lotus/upgrades/skins/scarves/grnstrapsscarf": { + "value": "Laddak Cloak" + }, + "/lotus/upgrades/skins/scarves/grnvhcape": { + "value": "Maggor Syandana" + }, + "/lotus/upgrades/skins/scarves/halloweenerosioncape": { + "value": "Day of the Dead Abrasys Syandana" + }, + "/lotus/upgrades/skins/scarves/halloweenfireflyscarf": { + "value": "Day of the Dead Igaro Synandana" + }, + "/lotus/upgrades/skins/scarves/halloweengrnbannerscarf": { + "value": "Day of the Dead Vanquished Banner" + }, + "/lotus/upgrades/skins/scarves/halloweenkyropterascarf": { + "value": "Day of the Dead Kyroptera Syandana" + }, + "/lotus/upgrades/skins/scarves/holidayturtleneckscarf": { + "value": "Festive Imperator Syandana" + }, + "/lotus/upgrades/skins/scarves/infscarfribcage": { + "value": "Thorac Syandana" + }, + "/lotus/upgrades/skins/scarves/kazinfestedscarf": { + "value": "Apoxys Syandana" + }, + "/lotus/upgrades/skins/scarves/magdeluxescarf": { + "value": "Vasa Syandana" + }, + "/lotus/upgrades/skins/scarves/swrthreeaquirosscarf": { + "value": "S W R Three Aquiros Scarf" + }, + "/lotus/upgrades/skins/scarves/swrthreensaruscarf": { + "value": "S W R Three Nsaru Scarf" + }, + "/lotus/upgrades/skins/scarves/tnglasssyandana": { + "value": "Hyalus Syandana" + }, + "/lotus/upgrades/skins/scarves/tnguandaoscarf": { + "value": "Mozi Syandana" + }, + "/lotus/upgrades/skins/sentinels/persiandjinnskin": { + "value": "Djinn Gazal Skin" + }, + "/lotus/upgrades/skins/sigils/projectsinistersigil": { + "value": "Project Sinister Sigil" + }, + "/lotus/upgrades/skins/sigils/scarsigil": { + "value": "Scar Sigil" + }, + "/lotus/upgrades/skins/sigils/syndicatesigilsteelmeridianj": { + "value": "Syndicate Sigil Steel Meridian J" + }, + "/lotus/upgrades/skins/sigils/syndicatesigilsteelmeridiank": { + "value": "Syndicate Sigil Steel Meridian K" + }, + "/lotus/upgrades/skins/trapper/vaubanalternateskin": { + "value": "Vauban Immortal Skin" + }, + "/lotus/upgrades/skins/trinity/trinityalternateskin": { + "value": "Trinity Immortal Skin" + }, + "/lotus/upgrades/skins/trinity/trinitydeluxesuit": { + "value": "Trinity Strega Skin" + }, + "/lotus/upgrades/skins/voices/operatorvoicecitem": { + "value": "Operator Voice C Item" + }, + "/lotus/upgrades/skins/voidtrader/vtexcaliburskin": { + "value": "Excalibur Prisma Skin" + }, + "/lotus/upgrades/skins/volt/voltalternateskin": { + "value": "Volt Immortal Skin" + }, + "/lotus/weapons/cephalon/melee/hammer/cephhammerweapon": { + "value": "Heliocor" + }, + "/lotus/weapons/cephalon/primary/cephprimary/cephprimary": { + "value": "Simulor" + }, + "/lotus/weapons/clantech/bio/aciddartpistol": { + "value": "Acrid" + }, + "/lotus/weapons/clantech/bio/bioweapon": { + "value": "Torid" + }, + "/lotus/weapons/clantech/chemical/flamethrower": { + "value": "Ignis" + }, + "/lotus/weapons/clantech/chemical/flamethrowerwraith": { + "value": "Ignis Wraith" + }, + "/lotus/weapons/clantech/chemical/rocketlauncher": { + "value": "Ogris" + }, + "/lotus/weapons/clantech/energy/crpheavyrifle": { + "value": "Supra" + }, + "/lotus/weapons/clantech/energy/crplaserpistol": { + "value": "Spectra" + }, + "/lotus/weapons/clantech/energy/crplaserrifle": { + "value": "Prova" + }, + "/lotus/weapons/clantech/energy/deravandal": { + "value": "Dera Vandal" + }, + "/lotus/weapons/clantech/energy/electroprod": { + "value": "Electro Prod" + }, + "/lotus/weapons/clantech/energy/energyrifle": { + "value": "Dera" + }, + "/lotus/weapons/clantech/energy/railgun": { + "value": "Lanka" + }, + "/lotus/weapons/clantech/energy/vandalelectroprod": { + "value": "Prova Vandal" + }, + "/lotus/weapons/corpus/bow/longbow/crpbow": { + "value": "Crp Bow" + }, + "/lotus/weapons/corpus/longguns/chainlightninggun/chainlightningrifle": { + "value": "Amprex" + }, + "/lotus/weapons/corpus/longguns/corpusump/corpusump": { + "value": "Tetra" + }, + "/lotus/weapons/corpus/longguns/corpusump/prismacorpusump": { + "value": "Prisma Tetra" + }, + "/lotus/weapons/corpus/longguns/crpbfg/conclavebfg": { + "value": "Conclave B F G" + }, + "/lotus/weapons/corpus/longguns/crpbfg/crpbfg": { + "value": "Opticor" + }, + "/lotus/weapons/corpus/longguns/crpfreezeray/crpfreezerayrifle": { + "value": "Glaxion" + }, + "/lotus/weapons/corpus/longguns/crpshockrifle/crpshockrifle": { + "value": "Quanta" + }, + "/lotus/weapons/corpus/longguns/crpshockrifle/quantavandal": { + "value": "Quanta Vandal" + }, + "/lotus/weapons/corpus/longguns/crpshotgun/crpshotgun": { + "value": "Arca Plasmor" + }, + "/lotus/weapons/corpus/longguns/crpsplitlaser/crpsplitlaser": { + "value": "Convectrix" + }, + "/lotus/weapons/corpus/longguns/grenadelauncher/grenadelauncher": { + "value": "Penta" + }, + "/lotus/weapons/corpus/longguns/machinegun/supravandal": { + "value": "Supra Vandal" + }, + "/lotus/weapons/corpus/longguns/spears/railgun/corpusrailgun": { + "value": "Corpus Railgun" + }, + "/lotus/weapons/corpus/melee/crptonfa/crptonfa": { + "value": "Ohma" + }, + "/lotus/weapons/corpus/melee/hammer/corpushammerweapon": { + "value": "Arca Titron" + }, + "/lotus/weapons/corpus/melee/kickandpunch/kickpunchweapon": { + "value": "Obex" + }, + "/lotus/weapons/corpus/melee/kickandpunch/prismaobex": { + "value": "Prisma Obex" + }, + "/lotus/weapons/corpus/melee/polearm/corpuspolearm01/corpuspolearmweapon": { + "value": "Serro" + }, + "/lotus/weapons/corpus/melee/whip/corpuswhipweapon": { + "value": "Lecta" + }, + "/lotus/weapons/corpus/pistols/corpushandshotgun/corpushandcannon": { + "value": "Detron" + }, + "/lotus/weapons/corpus/pistols/corpusminigun/corpusminigun": { + "value": "Cestra" + }, + "/lotus/weapons/corpus/pistols/corpusminigun/dualcorpusminigun": { + "value": "Dual Cestra" + }, + "/lotus/weapons/corpus/pistols/crpairpistol/crpairpistolarray": { + "value": "Sonicor" + }, + "/lotus/weapons/corpus/pistols/crpchargegun/crpchargegun": { + "value": "Crp Charge Gun" + }, + "/lotus/weapons/corpus/pistols/crpelectromag/crpelectromag": { + "value": "Staticor" + }, + "/lotus/weapons/corpus/pistols/crphandrl/corpushandrocketlauncher": { + "value": "Angstrum" + }, + "/lotus/weapons/corpus/pistols/sniperpistol/crpscopegun": { + "value": "Arca Scisco" + }, + "/lotus/weapons/grineer/emplacements/grndeployablecover/aridgrndeployablecover": { + "value": "Arid Grn Deployable Cover" + }, + "/lotus/weapons/grineer/emplacements/grndeployablecover/grineerdeployablecover": { + "value": "Grineer Deployable Cover" + }, + "/lotus/weapons/grineer/emplacements/grndeployablecoverqueen/queengrndeployablecover": { + "value": "Queen Grn Deployable Cover" + }, + "/lotus/weapons/grineer/emplacements/grnemplcmntstndng/grineeremplacementstanding": { + "value": "Grineer Emplacement Standing" + }, + "/lotus/weapons/grineer/emplacements/grnemplcmntstndng/grineerfortressemplacementstanding": { + "value": "Grineer Fortress Emplacement Standing" + }, + "/lotus/weapons/grineer/grineerpistol/grineerakimbopistol": { + "value": "Twin Gremlins" + }, + "/lotus/weapons/grineer/grineerpistol/grineerlightpistol": { + "value": "Viper" + }, + "/lotus/weapons/grineer/grineerpistol/grnheavypistol": { + "value": "Kracken" + }, + "/lotus/weapons/grineer/grineerpistol/grnscopedpistolplayer": { + "value": "Seer" + }, + "/lotus/weapons/grineer/longguns/burstrifle/grnburstrifle": { + "value": "Hind" + }, + "/lotus/weapons/grineer/longguns/grineerassaultrifle/grnassaultrifle": { + "value": "Grinlok" + }, + "/lotus/weapons/grineer/longguns/grineerassaultrifle/twingrakatas": { + "value": "Twin Grakatas" + }, + "/lotus/weapons/grineer/longguns/grineerflakcannon/flakcannon": { + "value": "Flak Cannon" + }, + "/lotus/weapons/grineer/longguns/grineerleveractionrifle/glarifle": { + "value": "G L A Rifle" + }, + "/lotus/weapons/grineer/longguns/grineerm16homage/grineerm16rifle": { + "value": "Karak" + }, + "/lotus/weapons/grineer/longguns/grineerm16homage/karakwraith": { + "value": "Velocitus" + }, + "/lotus/weapons/grineer/longguns/grineersawbladegun/sawbladegun": { + "value": "Miter" + }, + "/lotus/weapons/grineer/longguns/grineersniperrifle/grnsniperrifle": { + "value": "Vulkor" + }, + "/lotus/weapons/grineer/longguns/grineersniperrifle/vulkarwraith": { + "value": "Vulkar Wraith" + }, + "/lotus/weapons/grineer/longguns/grncannon/grncannonweapon": { + "value": "Zarr" + }, + "/lotus/weapons/grineer/longguns/grnflamespear/grnflamespear": { + "value": "Javlok" + }, + "/lotus/weapons/grineer/longguns/grnfourbarrelrifle/grnfourbarrelrifleweapon": { + "value": "Quartakk" + }, + "/lotus/weapons/grineer/longguns/grngorgsniperrifle/grngorgsniperrifle": { + "value": "Buzlok" + }, + "/lotus/weapons/grineer/longguns/grngrenadelauncher/grngrenadelauncher": { + "value": "Tonkor" + }, + "/lotus/weapons/grineer/longguns/grnharpoongun/grnharpoongun": { + "value": "Harpack" + }, + "/lotus/weapons/grineer/longguns/grnspark/grnsparkrifle": { + "value": "Kohm" + }, + "/lotus/weapons/grineer/longguns/laseraimrifle/laseraimrifle": { + "value": "Argonak" + }, + "/lotus/weapons/grineer/longguns/voidtradergorgon/vtgorgon": { + "value": "Prisma Gorgon" + }, + "/lotus/weapons/grineer/longguns/wraithgorgon/wraithgorgon": { + "value": "Gorgon Wraith" + }, + "/lotus/weapons/grineer/melee/grineerclaws/grnclaws": { + "value": "Ripkas" + }, + "/lotus/weapons/grineer/melee/grineercombatknife/grineercombatknife": { + "value": "Sheev" + }, + "/lotus/weapons/grineer/melee/grineerhalberd/grnhalberd": { + "value": "Kesheg" + }, + "/lotus/weapons/grineer/melee/grineerjetpoweredpolearm/grineerjetpolearm": { + "value": "Jat Kittag" + }, + "/lotus/weapons/grineer/melee/grineermachetteandcleaver/dualcleaverweapon": { + "value": "Dual Cleavers" + }, + "/lotus/weapons/grineer/melee/grineermachetteandcleaver/machete": { + "value": "Machete" + }, + "/lotus/weapons/grineer/melee/grineermachetteandcleaver/prismadualcleavers": { + "value": "Prisma Dual Cleavers" + }, + "/lotus/weapons/grineer/melee/grineermachetteandcleaver/wraithmacheteweapon": { + "value": "Machete Wraith" + }, + "/lotus/weapons/grineer/melee/grineertylaxeandboar/regoraxeshield": { + "value": "Ack & Brunt" + }, + "/lotus/weapons/grineer/melee/grineerwhip/grineerwhip": { + "value": "Atterak" + }, + "/lotus/weapons/grineer/melee/grnboomerang/grnboomerang": { + "value": "Halikar Boomerang" + }, + "/lotus/weapons/grineer/melee/grndualfireaxe/grndualfireaxe": { + "value": "Twin Basolk" + }, + "/lotus/weapons/grineer/melee/grnegyptswd/grnegyptswdweapon": { + "value": "Krohkur" + }, + "/lotus/weapons/grineer/melee/grnkusarigama/grnkusarigamaweapon": { + "value": "Grn Kusarigama Weapon" + }, + "/lotus/weapons/grineer/melee/grnqueensceptre/grnqueensceptreweapon": { + "value": "Broken Scepter" + }, + "/lotus/weapons/grineer/melee/grntrident/grntridentweapon": { + "value": "Sydon" + }, + "/lotus/weapons/grineer/pistols/grineercrossbow/grineergoogun": { + "value": "Stug" + }, + "/lotus/weapons/grineer/pistols/grineerhandshotgun/grineerhandcannon": { + "value": "Grineer Hand Cannon" + }, + "/lotus/weapons/grineer/pistols/grineerleveractionpistol/glapistol": { + "value": "Marelok" + }, + "/lotus/weapons/grineer/pistols/grineermicrowavegun/grnmicrowavepistol": { + "value": "Nukor" + }, + "/lotus/weapons/grineer/pistols/grndwuniques/grntwinkohmaks": { + "value": "Twin Kohmak" + }, + "/lotus/weapons/grineer/pistols/grnkohmpistol/grnkohmpistol": { + "value": "Kohmak" + }, + "/lotus/weapons/grineer/pistols/grnqueenguarddualpistol/grnqueenguarddualpistols": { + "value": "Twin Rogga" + }, + "/lotus/weapons/grineer/pistols/grntorpedopistol/grntorpedopistol": { + "value": "Kulstar" + }, + "/lotus/weapons/grineer/pistols/grnuzi/grnuziweapon": { + "value": "Stubba" + }, + "/lotus/weapons/grineer/pistols/heatgun/grnheatgun": { + "value": "Atomos" + }, + "/lotus/weapons/grineer/pistols/wraithtwinvipers/wraithtwinvipers": { + "value": "Wraith Twin Vipers" + }, + "/lotus/weapons/grineer/shield/shieldattachment": { + "value": "Shield Attachment" + }, + "/lotus/weapons/infested/bow/infcernosbow/infcernos": { + "value": "Mutalist Cernos" + }, + "/lotus/weapons/infested/longguns/infcrpshockswarm/infcrpshockswarmrifle": { + "value": "Mutalist Quanta" + }, + "/lotus/weapons/infested/longguns/infestedrifle": { + "value": "Synapse" + }, + "/lotus/weapons/infested/longguns/infwfaccompanyingpri/infestedburstrifle": { + "value": "Hema" + }, + "/lotus/weapons/infested/longguns/quantafullyinfested/infquantarifle": { + "value": "Mutalist Quanta" + }, + "/lotus/weapons/infested/longguns/tentacluster/infestedshotgun": { + "value": "Phage" + }, + "/lotus/weapons/infested/melee/glaives/punctureglaive/punctureglaiveweapon": { + "value": "Cerata" + }, + "/lotus/weapons/infested/melee/infembolistscythe/infestedscythe": { + "value": "Caustacyst" + }, + "/lotus/weapons/infested/melee/infwfaccompanyingsparring/infestedkogake": { + "value": "Hirudo" + }, + "/lotus/weapons/infested/melee/swords/mios/mios": { + "value": "Mios" + }, + "/lotus/weapons/infested/melee/swords/mire/miresword": { + "value": "Mire" + }, + "/lotus/weapons/infested/melee/tipedostaff/inftipedostaff": { + "value": "Lesion" + }, + "/lotus/weapons/infested/melee/whip/infestedwhip/infestedwhipweapon": { + "value": "Mios" + }, + "/lotus/weapons/infested/pistols/infesteddartpistol/infesteddartpistol": { + "value": "Tysis" + }, + "/lotus/weapons/infested/pistols/infestedpistol": { + "value": "Embolist" + }, + "/lotus/weapons/infested/pistols/infproximitystars/infproximitystars": { + "value": "Pox" + }, + "/lotus/weapons/infested/pistols/infvomitgun/infvomitgunwep": { + "value": "Dual Toxocyst" + }, + "/lotus/weapons/mk1series/mk1bo": { + "value": "MK1-Bo" + }, + "/lotus/weapons/mk1series/mk1braton": { + "value": "MK1-Braton" + }, + "/lotus/weapons/mk1series/mk1furax": { + "value": "MK1-Furax" + }, + "/lotus/weapons/mk1series/mk1furis": { + "value": "MK1-Furis" + }, + "/lotus/weapons/mk1series/mk1kunai": { + "value": "MK1-Kunai" + }, + "/lotus/weapons/mk1series/mk1strun": { + "value": "MK1 Strun" + }, + "/lotus/weapons/syndicates/arbitersofhexis/longguns/ahboltor": { + "value": "Telos Boltor" + }, + "/lotus/weapons/syndicates/arbitersofhexis/melee/ahboltace": { + "value": "Telos Boltace" + }, + "/lotus/weapons/syndicates/arbitersofhexis/pistols/ahakbolto": { + "value": "Telos Akbolto" + }, + "/lotus/weapons/syndicates/cephalonsuda/longguns/cssimulor": { + "value": "Synoid Simulor" + }, + "/lotus/weapons/syndicates/cephalonsuda/melee/csheliocor": { + "value": "Synoid Heliocor" + }, + "/lotus/weapons/syndicates/cephalonsuda/pistols/csdroidarray": { + "value": "Gammacor" + }, + "/lotus/weapons/syndicates/cephalonsuda/pistols/cssynoidgammacor": { + "value": "Synoid Synoid Gammacor" + }, + "/lotus/weapons/syndicates/newloka/longguns/nltigris": { + "value": "Sancti Tigris" + }, + "/lotus/weapons/syndicates/newloka/melee/nlmagistar": { + "value": "Sancti Magistar" + }, + "/lotus/weapons/syndicates/newloka/pistols/nlcastanas": { + "value": "Sancti Castanas" + }, + "/lotus/weapons/syndicates/perrinsequence/longguns/pspenta": { + "value": "Secura Penta" + }, + "/lotus/weapons/syndicates/perrinsequence/melee/pslecta": { + "value": "Secura Lecta" + }, + "/lotus/weapons/syndicates/perrinsequence/pistols/psdualcestra": { + "value": "Secura Dual Cestra" + }, + "/lotus/weapons/syndicates/redveil/bows/rvcernos": { + "value": "Rakta Cernos" + }, + "/lotus/weapons/syndicates/redveil/melee/rvdarkdagger": { + "value": "Rakta Dark Dagger" + }, + "/lotus/weapons/syndicates/redveil/pistols/rvballistica": { + "value": "Rakta Ballistica" + }, + "/lotus/weapons/syndicates/steelmeridian/longguns/smhek": { + "value": "Vaykor Hek" + }, + "/lotus/weapons/syndicates/steelmeridian/melee/smsydon": { + "value": "Vaykor Sydon" + }, + "/lotus/weapons/syndicates/steelmeridian/pistols/smmarelok": { + "value": "Vaykor Marelok" + }, + "/lotus/weapons/tenno/akimbo/akimboautopistols": { + "value": "Afuris" + }, + "/lotus/weapons/tenno/akimbo/akimbobolto": { + "value": "AkBolto" + }, + "/lotus/weapons/tenno/akimbo/akimbopistol": { + "value": "AkLato" + }, + "/lotus/weapons/tenno/akimbo/akimboshotgun": { + "value": "AkBronco" + }, + "/lotus/weapons/tenno/akimbo/akimboviperpistols": { + "value": "Twin Vipers" + }, + "/lotus/weapons/tenno/akimbo/aklexpistols": { + "value": "AkLex" + }, + "/lotus/weapons/tenno/akimbo/aklexprimepistols": { + "value": "AkLex Prime" + }, + "/lotus/weapons/tenno/akimbo/dualmagnus": { + "value": "AkMagnus" + }, + "/lotus/weapons/tenno/akimbo/dualvastos": { + "value": "AkVastos" + }, + "/lotus/weapons/tenno/akimbo/primeakimboshotgun": { + "value": "AkBronco Prime" + }, + "/lotus/weapons/tenno/archwing/melee/archaxe/archaxeweapon": { + "value": "Onorix" + }, + "/lotus/weapons/tenno/archwing/melee/archhammer/archhammer": { + "value": "Rathbone" + }, + "/lotus/weapons/tenno/archwing/melee/archscythe/archscythe": { + "value": "Kaszas" + }, + "/lotus/weapons/tenno/archwing/melee/archsword/archswordweapon": { + "value": "Veritux" + }, + "/lotus/weapons/tenno/archwing/melee/archswordandshield/archswordshield": { + "value": "Centaur" + }, + "/lotus/weapons/tenno/archwing/melee/archswordhook/archhookswordweapon": { + "value": "Agkuza Arch-melee" + }, + "/lotus/weapons/tenno/archwing/melee/grnarchhand/grnarchhandweapon": { + "value": "Knux" + }, + "/lotus/weapons/tenno/archwing/melee/voidtraderarchsword/vtarchswordweapon": { + "value": "Prisma Veritux" + }, + "/lotus/weapons/tenno/archwing/primary/archburstgun/archburstgun": { + "value": "Cyngas Arch-gun" + }, + "/lotus/weapons/tenno/archwing/primary/archwingheavypistols/archheavypistols": { + "value": "Dual Decurion" + }, + "/lotus/weapons/tenno/archwing/primary/foldingmachinegun/archmachinegun": { + "value": "Imperator" + }, + "/lotus/weapons/tenno/archwing/primary/foldingmachinegun/archmachinegunvandal": { + "value": "Imperator Vandal" + }, + "/lotus/weapons/tenno/archwing/primary/launchgrenade/archcannon": { + "value": "Corvas" + }, + "/lotus/weapons/tenno/archwing/primary/railgun/archrailgun": { + "value": "Arch Railgun" + }, + "/lotus/weapons/tenno/archwing/primary/repurposedgrineerantiaircraftgun/archgrnaagun": { + "value": "Grattler" + }, + "/lotus/weapons/tenno/archwing/primary/rocketartillery/archrocketcrossbow": { + "value": "Fluctus" + }, + "/lotus/weapons/tenno/bows/antlerbow/antlerbow": { + "value": "Cernos" + }, + "/lotus/weapons/tenno/bows/asymetricalbow/asymetricalbow": { + "value": "Daikyu" + }, + "/lotus/weapons/tenno/bows/huntingbow": { + "value": "Paris" + }, + "/lotus/weapons/tenno/bows/primecernos/primecernos": { + "value": "Cernos Prime" + }, + "/lotus/weapons/tenno/bows/primehuntingbow": { + "value": "Paris Prime" + }, + "/lotus/weapons/tenno/bows/stalkerbow": { + "value": "Dread" + }, + "/lotus/weapons/tenno/bows/valentinesconclavevariantbow": { + "value": "Valentines Conclave Variant Bow" + }, + "/lotus/weapons/tenno/longguns/dexthethird/dexthethird": { + "value": "Dex Sybaris" + }, + "/lotus/weapons/tenno/longguns/doublebarrelshotgun/tennodoublebarrelshotgun": { + "value": "Tigris" + }, + "/lotus/weapons/tenno/longguns/drakerifle/drakerifle": { + "value": "Tiberon" + }, + "/lotus/weapons/tenno/longguns/fiveshotsniper/fiveshotsniper": { + "value": "Rubico" + }, + "/lotus/weapons/tenno/longguns/loginprimary/sundialrifle": { + "value": "Sundial Rifle" + }, + "/lotus/weapons/tenno/longguns/miter/tnomiter": { + "value": "Panthera" + }, + "/lotus/weapons/tenno/longguns/primeboltor/primeboltor": { + "value": "Boltor Prime" + }, + "/lotus/weapons/tenno/longguns/primeburston/primeburston": { + "value": "Burston Prime" + }, + "/lotus/weapons/tenno/longguns/primesoma/primesomarifle": { + "value": "Soma Prime" + }, + "/lotus/weapons/tenno/longguns/primesybaris/primesybarisrifle": { + "value": "Sybaris Prime" + }, + "/lotus/weapons/tenno/longguns/primetigris/primetigris": { + "value": "Tigris Prime" + }, + "/lotus/weapons/tenno/longguns/primevectis/primevectisrifle": { + "value": "Prime Vectis" + }, + "/lotus/weapons/tenno/longguns/repeatingcrossbow/repeatingcrossbow": { + "value": "Zhuge" + }, + "/lotus/weapons/tenno/longguns/tennotommygun/tennotommygunrifle": { + "value": "Stradavar" + }, + "/lotus/weapons/tenno/longguns/tnbardrifle/tnbardrifle": { + "value": "Tenora" + }, + "/lotus/weapons/tenno/longguns/tnglassshotgun/tnglassshotgungun": { + "value": "Astilla" + }, + "/lotus/weapons/tenno/longguns/tnheavyshotgun/tnheavyshotgungun": { + "value": "Corinth" + }, + "/lotus/weapons/tenno/longguns/tnoleveraction/tnoleveractionrifle": { + "value": "Sybaris" + }, + "/lotus/weapons/tenno/longguns/tnoprmryxbow/tnoprmryxbowweapon": { + "value": "Attica" + }, + "/lotus/weapons/tenno/longguns/tnpriestspear/tnpriestspeargun": { + "value": "Tn Priest Spear Gun" + }, + "/lotus/weapons/tenno/longguns/tnsmg/tnsmgweapon": { + "value": "Baza" + }, + "/lotus/weapons/tenno/longguns/wraithlatron/wraithlatron": { + "value": "Latron Wraith" + }, + "/lotus/weapons/tenno/melee/axe/axeweapon": { + "value": "Scindo" + }, + "/lotus/weapons/tenno/melee/axe/dualaxeweapon": { + "value": "Dual Zoren" + }, + "/lotus/weapons/tenno/melee/axe/dualinfestedaxesweapon": { + "value": "Dual Ichor" + }, + "/lotus/weapons/tenno/melee/axe/primescindo/primescindoweapon": { + "value": "Scindo Prime" + }, + "/lotus/weapons/tenno/melee/brass knuckles/brassknuckles": { + "value": "Kogake" + }, + "/lotus/weapons/tenno/melee/claws/tennoclaws": { + "value": "Venka" + }, + "/lotus/weapons/tenno/melee/cronussword/cronuslongsword": { + "value": "Cronus" + }, + "/lotus/weapons/tenno/melee/cronussword/primecronuslongsword": { + "value": "Dakra Prime" + }, + "/lotus/weapons/tenno/melee/dagger/ceramicdagger": { + "value": "Ceramic Dagger" + }, + "/lotus/weapons/tenno/melee/dagger/dagger": { + "value": "Heat Dagger" + }, + "/lotus/weapons/tenno/melee/dagger/darkdagger": { + "value": "Dark Dagger" + }, + "/lotus/weapons/tenno/melee/dualdagger/dualdagger": { + "value": "Fang" + }, + "/lotus/weapons/tenno/melee/dualdagger/dualetherdagger": { + "value": "Dual Ether Dagger" + }, + "/lotus/weapons/tenno/melee/dualdagger/fangprimedagger": { + "value": "Fang Prime" + }, + "/lotus/weapons/tenno/melee/dualkamas/dualkamas": { + "value": "Dual Kamas" + }, + "/lotus/weapons/tenno/melee/dualkamas/singlekama": { + "value": "Kama" + }, + "/lotus/weapons/tenno/melee/dualshortsword/dualethersword": { + "value": "Dual Ether" + }, + "/lotus/weapons/tenno/melee/dualshortsword/dualheatswords": { + "value": "Dual Heat Swords" + }, + "/lotus/weapons/tenno/melee/dualshortsword/dualshortsword": { + "value": "Dual Ether" + }, + "/lotus/weapons/tenno/melee/fist/fist": { + "value": "Furax" + }, + "/lotus/weapons/tenno/melee/fist/furaxwraith": { + "value": "Furax Wraith" + }, + "/lotus/weapons/tenno/melee/gauntlet/brawlerknuckles/brawlerknuckles": { + "value": "Tekko" + }, + "/lotus/weapons/tenno/melee/gauntlet/gauntlet": { + "value": "Ankyros" + }, + "/lotus/weapons/tenno/melee/gauntlet/primeankyros/primeankyros": { + "value": "Ankyros Prime" + }, + "/lotus/weapons/tenno/melee/glaives/boomerang/boomerangweapon": { + "value": "Kestrel" + }, + "/lotus/weapons/tenno/melee/glaives/lightglaive/lightglaiveweapon": { + "value": "Glaive" + }, + "/lotus/weapons/tenno/melee/glaives/primeglaive/primeglaiveweapon": { + "value": "Glaive Prime" + }, + "/lotus/weapons/tenno/melee/glaives/teshinglaive/tnteshinglaivewep": { + "value": "Orvius" + }, + "/lotus/weapons/tenno/melee/greatsword/greatsword": { + "value": "Gram" + }, + "/lotus/weapons/tenno/melee/gunblade/gunbladeautomatic/tnogunbladeautomatic": { + "value": "Gunblade" + }, + "/lotus/weapons/tenno/melee/gunblade/tnogunblade": { + "value": "Redeemer" + }, + "/lotus/weapons/tenno/melee/hammer/glasshammer/glasshammer": { + "value": "Volnus" + }, + "/lotus/weapons/tenno/melee/hammer/hammerweapon": { + "value": "Fragor" + }, + "/lotus/weapons/tenno/melee/hammer/icehammer/icehammer": { + "value": "Sibear" + }, + "/lotus/weapons/tenno/melee/longsword/ethersword": { + "value": "Ether Sword" + }, + "/lotus/weapons/tenno/melee/longsword/longsword": { + "value": "Skana" + }, + "/lotus/weapons/tenno/melee/longsword/skanaprime": { + "value": "Skana Prime" + }, + "/lotus/weapons/tenno/melee/maces/paladinmace/paladinmaceweapon": { + "value": "Magistar" + }, + "/lotus/weapons/tenno/melee/nunchaku/nunchaku/nunchaku": { + "value": "Nonkondi" + }, + "/lotus/weapons/tenno/melee/nunchaku/tnonunchaku/tnonunchaku": { + "value": "Shaku" + }, + "/lotus/weapons/tenno/melee/persianmachete/djinnmachete": { + "value": "Gazal" + }, + "/lotus/weapons/tenno/melee/polearms/flowerpowerpolearm/flowerpowerpolearmwep": { + "value": "Tonbo" + }, + "/lotus/weapons/tenno/melee/polearms/polearmweapon": { + "value": "Orthos" + }, + "/lotus/weapons/tenno/melee/polearms/primepolearmweapon": { + "value": "Orthos Prime" + }, + "/lotus/weapons/tenno/melee/polearms/tnguandaopolearm/tnguandaopolearmweapon": { + "value": "Tn Guandao Polearm Weapon" + }, + "/lotus/weapons/tenno/melee/polearms/tnhalberdpolearm/tnhalberdpolearmweapon": { + "value": "Cassowar" + }, + "/lotus/weapons/tenno/melee/primedualkamas/primedualkamas": { + "value": "Dual Kamas Prime" + }, + "/lotus/weapons/tenno/melee/primefragor/primefragor": { + "value": "Fragor Prime" + }, + "/lotus/weapons/tenno/melee/primevenka/primevenkaclaws": { + "value": "Venka Prime" + }, + "/lotus/weapons/tenno/melee/scythe/etherscytheweapon": { + "value": "Ether Reaper" + }, + "/lotus/weapons/tenno/melee/scythe/parisscythe/parisscythe": { + "value": "Anku" + }, + "/lotus/weapons/tenno/melee/scythe/parisscythe/variantxmasscythe": { + "value": "Variant Xmas Scythe" + }, + "/lotus/weapons/tenno/melee/scythe/reaperweapon": { + "value": "Reaper Prime" + }, + "/lotus/weapons/tenno/melee/scythe/stalkerscytheweapon": { + "value": "Hate" + }, + "/lotus/weapons/tenno/melee/soma/somadualkamas": { + "value": "Dual Raza" + }, + "/lotus/weapons/tenno/melee/staff/grnstaff": { + "value": "Amphis" + }, + "/lotus/weapons/tenno/melee/staff/monkspade/tnomonkstaff": { + "value": "Tipedo" + }, + "/lotus/weapons/tenno/melee/staff/primebo/primeboweapon": { + "value": "Bo Prime" + }, + "/lotus/weapons/tenno/melee/staff/staff": { + "value": "Bo" + }, + "/lotus/weapons/tenno/melee/sundialaxe/sundialaxeweapon": { + "value": "Zenistar" + }, + "/lotus/weapons/tenno/melee/swords/cutlassandpoignard/cutlasspoignardswords": { + "value": "Nami Skyla" + }, + "/lotus/weapons/tenno/melee/swords/cutlassandpoignard/tennocutlass": { + "value": "Nami Solo" + }, + "/lotus/weapons/tenno/melee/swords/darksword/darklongsword": { + "value": "Dark Sword" + }, + "/lotus/weapons/tenno/melee/swords/darksword/darksworddaggerhybridweapon": { + "value": "Dark Split-Sword" + }, + "/lotus/weapons/tenno/melee/swords/dexthesecond/dexthesecond": { + "value": "Dex Dakra" + }, + "/lotus/weapons/tenno/melee/swords/greatsword/tennogreatsword": { + "value": "Galatine" + }, + "/lotus/weapons/tenno/melee/swords/heatsword/heatlongsword": { + "value": "Heat Sword" + }, + "/lotus/weapons/tenno/melee/swords/jawsword/jawlongsword": { + "value": "Jaw Sword" + }, + "/lotus/weapons/tenno/melee/swords/katanaandwakizashi/katana": { + "value": "Nikana" + }, + "/lotus/weapons/tenno/melee/swords/katanaandwakizashi/lowkatana": { + "value": "Dragon Nikana" + }, + "/lotus/weapons/tenno/melee/swords/katanaandwakizashi/variantkatana": { + "value": "Variant Katana" + }, + "/lotus/weapons/tenno/melee/swords/krisdagger/krisdagger": { + "value": "Karyst" + }, + "/lotus/weapons/tenno/melee/swords/pangolinsword/pangolinlongsword": { + "value": "Pangolin Sword" + }, + "/lotus/weapons/tenno/melee/swords/plasmasword/plasmalongsword": { + "value": "Plasma Sword" + }, + "/lotus/weapons/tenno/melee/swords/primegalatine/primegalatine": { + "value": "Galatine Prime" + }, + "/lotus/weapons/tenno/melee/swords/primekatana/primenikana": { + "value": "Nikana Prime" + }, + "/lotus/weapons/tenno/melee/swords/stalkermios/stalkermios": { + "value": "Lacera" + }, + "/lotus/weapons/tenno/melee/swords/stalkertwo/stalkertwogreatsword": { + "value": "War" + }, + "/lotus/weapons/tenno/melee/swords/stalkertwo/stalkertwosmallsword": { + "value": "Broken War" + }, + "/lotus/weapons/tenno/melee/swords/tennosai/tennosais": { + "value": "Okina" + }, + "/lotus/weapons/tenno/melee/swords/threeleaf/threeleaf": { + "value": "Three Leaf" + }, + "/lotus/weapons/tenno/melee/swords/tnorapier/tnorapier": { + "value": "Destreza" + }, + "/lotus/weapons/tenno/melee/swordsandboards/meleecontestwinnerone/tennoswordshield": { + "value": "Silva & Aegis" + }, + "/lotus/weapons/tenno/melee/tonfa/boltonfa/boltonfa": { + "value": "Boltace" + }, + "/lotus/weapons/tenno/melee/tonfa/tonfacontestwinner/tennotonfa": { + "value": "Kronen" + }, + "/lotus/weapons/tenno/pistol/autopistol": { + "value": "Furis" + }, + "/lotus/weapons/tenno/pistol/broncoprime": { + "value": "Bronco Prime" + }, + "/lotus/weapons/tenno/pistol/burstpistol": { + "value": "Sicarus" + }, + "/lotus/weapons/tenno/pistol/crossbow": { + "value": "Ballistica" + }, + "/lotus/weapons/tenno/pistol/handshotgun": { + "value": "Pyrana" + }, + "/lotus/weapons/tenno/pistol/heavypistol": { + "value": "Lex" + }, + "/lotus/weapons/tenno/pistol/latoprime": { + "value": "Lato Prime" + }, + "/lotus/weapons/tenno/pistol/latovandal": { + "value": "Lato Vandal" + }, + "/lotus/weapons/tenno/pistol/pistol": { + "value": "Bolto" + }, + "/lotus/weapons/tenno/pistol/revolverpistol": { + "value": "Vasto" + }, + "/lotus/weapons/tenno/pistols/allnew1hsg/allnew1hsg": { + "value": "Euphona Prime" + }, + "/lotus/weapons/tenno/pistols/automatichandcrossbow/autocrossbow": { + "value": "Ballistica" + }, + "/lotus/weapons/tenno/pistols/dexfuris/dexfuris": { + "value": "Dex Furis" + }, + "/lotus/weapons/tenno/pistols/harlequingun/harlequinpistols": { + "value": "Akzani" + }, + "/lotus/weapons/tenno/pistols/magnum/magnum": { + "value": "Magnus" + }, + "/lotus/weapons/tenno/pistols/primeakstiletto/primeakstiletto": { + "value": "Akstiletto Prime" + }, + "/lotus/weapons/tenno/pistols/primelex/primelex": { + "value": "Lex Prime" + }, + "/lotus/weapons/tenno/pistols/primesicarus/primesicaruspistol": { + "value": "Sicarus Prime" + }, + "/lotus/weapons/tenno/pistols/primevasto/primevastopistol": { + "value": "Vasto Prime" + }, + "/lotus/weapons/tenno/pistols/sawnoffshotgun/tennohandshotgun": { + "value": "Pyrana" + }, + "/lotus/weapons/tenno/pistols/somasidearm/akimbosomapistols": { + "value": "Aksomati" + }, + "/lotus/weapons/tenno/pistols/sundialgun/sundialpistol": { + "value": "Azima" + }, + "/lotus/weapons/tenno/pistols/tennouzi/tennouzi": { + "value": "Akstiletto" + }, + "/lotus/weapons/tenno/pistols/tigrisredeemersetpistol/tnobladedpistols": { + "value": "Akjagara" + }, + "/lotus/weapons/tenno/pistols/tnbardpistol/tnbardpistolgun": { + "value": "Pandero" + }, + "/lotus/weapons/tenno/pistols/tnguandopistol/tnguandopistolgun": { + "value": "Tn Guando Pistol Gun" + }, + "/lotus/weapons/tenno/pistols/tnpriestpistolscope/tnpriestpistolweapon": { + "value": "Tn Priest Pistol Weapon" + }, + "/lotus/weapons/tenno/rifle/boltorifle": { + "value": "Boltor" + }, + "/lotus/weapons/tenno/rifle/bratonprime": { + "value": "Braton Prime" + }, + "/lotus/weapons/tenno/rifle/burstrifle": { + "value": "Burston" + }, + "/lotus/weapons/tenno/rifle/heavyrifle": { + "value": "Gorgon" + }, + "/lotus/weapons/tenno/rifle/latronprime": { + "value": "Latron Prime" + }, + "/lotus/weapons/tenno/rifle/rifle": { + "value": "Braton" + }, + "/lotus/weapons/tenno/rifle/semiautorifle": { + "value": "Latron" + }, + "/lotus/weapons/tenno/rifle/sniperrifle": { + "value": "Snipetron" + }, + "/lotus/weapons/tenno/rifle/startingrifle": { + "value": "MK1-Braton" + }, + "/lotus/weapons/tenno/rifle/tennoar": { + "value": "Soma" + }, + "/lotus/weapons/tenno/rifle/tennosniperrifle": { + "value": "Vectis" + }, + "/lotus/weapons/tenno/rifle/vandalsniperrifle": { + "value": "Snipetron Vandal" + }, + "/lotus/weapons/tenno/shotgun/doublebarrelshotgun": { + "value": "Tigris" + }, + "/lotus/weapons/tenno/shotgun/eviseratorweapon": { + "value": "Eviserator Weapon" + }, + "/lotus/weapons/tenno/shotgun/fullautoshotgun": { + "value": "Boar" + }, + "/lotus/weapons/tenno/shotgun/primeboar": { + "value": "Boar Prime" + }, + "/lotus/weapons/tenno/shotgun/quadshotgun": { + "value": "Hek" + }, + "/lotus/weapons/tenno/shotgun/shotgun": { + "value": "Strun" + }, + "/lotus/weapons/tenno/shotgun/shotgunvandal": { + "value": "Strun Wraith" + }, + "/lotus/weapons/tenno/throwingweapons/glasskunai/glasskunaiweapon": { + "value": "Fusilai" + }, + "/lotus/weapons/tenno/throwingweapons/kunai": { + "value": "Kunai" + }, + "/lotus/weapons/tenno/throwingweapons/lidagger/lidagger": { + "value": "Spira" + }, + "/lotus/weapons/tenno/throwingweapons/primelidagger/primelidagger": { + "value": "Prime Li Dagger" + }, + "/lotus/weapons/tenno/throwingweapons/primethrowingstar/primehikou": { + "value": "Hikou Prime" + }, + "/lotus/weapons/tenno/throwingweapons/stalkerkunai": { + "value": "Despair" + }, + "/lotus/weapons/tenno/throwingweapons/stickybomb/stickybombs": { + "value": "Hikou" + }, + "/lotus/weapons/tenno/throwingweapons/tennostars": { + "value": "Tenno Stars" + }, + "/lotus/weapons/tenno/throwingweapons/u18throwingknives/u18throwingknives": { + "value": "Talons" + }, + "/lotus/weapons/tenno/throwingweapons/variantsnowballs": { + "value": "Variant Snow Balls" + }, + "/lotus/weapons/tenno/throwingweapons/varianttennostars": { + "value": "Variant Tenno Stars" + }, + "/lotus/weapons/voidtrader/prismagrakata": { + "value": "Prisma Grakata" + }, + "/lotus/weapons/voidtrader/prismaskana": { + "value": "Prisma Skana" + }, + "/lotus/weapons/voidtrader/vtdetron": { + "value": "Mara Detron" + }, + "5541862206c56f445f529122": { + "value": "5541862206c56f445f529122" + }, + "5541863a07c56f3d4adf9981": { + "value": "5541863a07c56f3d4adf9981" + }, + "55e4bd0c08c56fd36718a117": { + "value": "55e4bd0c08c56fd36718a117" + }, + "5640d72c07c56f2f397b25ce": { + "value": "5640d72c07c56f2f397b25ce" + }, + "5642b4d508c56ff9117b60be": { + "value": "5642b4d508c56ff9117b60be" + }, + "5642c37d07c56f8b317b5fdb": { + "value": "5642c37d07c56f8b317b5fdb" + }, + "ProjectIndex": { + "value": "Index Points" + } +} diff --git a/static/missionTypes.json b/static/missionTypes.json new file mode 100644 index 0000000..cf6c027 --- /dev/null +++ b/static/missionTypes.json @@ -0,0 +1,59 @@ +{ + "MT_EXCAVATE": { + "value": "Excavation" + }, + "MT_SABOTAGE": { + "value": "Sabotage" + }, + "MT_MOBILE_DEFENSE": { + "value": "Mobile Defense" + }, + "MT_ASSASSINATION": { + "value": "Assassination" + }, + "MT_EXTERMINATION": { + "value": "Extermination" + }, + "MT_HIVE": { + "value": "Hive" + }, + "MT_DEFENSE": { + "value": "Defense" + }, + "MT_TERRITORY": { + "value": "Interception" + }, + "MT_ARENA": { + "value": "Rathuum" + }, + "MT_PVP": { + "value": "Conclave" + }, + "MT_RESCUE": { + "value": "Rescue" + }, + "MT_INTEL": { + "value": "Spy" + }, + "MT_SURVIVAL": { + "value": "Survival" + }, + "MT_CAPTURE": { + "value": "Capture" + }, + "MT_SECTOR": { + "value": "Dark Sector" + }, + "MT_RETRIEVAL": { + "value": "Hijack" + }, + "MT_ASSAULT": { + "value": "Assault" + }, + "MT_EVACUATION": { + "value": "Defection" + }, + "MT_LANDSCAPE": { + "value": "Free Roam" + } +} diff --git a/static/solNodes.json b/static/solNodes.json new file mode 100644 index 0000000..dad8dfc --- /dev/null +++ b/static/solNodes.json @@ -0,0 +1,1792 @@ +{ + "SolNode0": { + "value": "SolNode0", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "SolNode1": { + "value": "Galatea (Neptune)", + "enemy": "Corpus", + "type": "Capture" + }, + "SolNode2": { + "value": "Aphrodite (Venus)", + "enemy": "Corpus", + "type": "Mobile Defense" + }, + "SolNode3": { + "value": "Cordelia (Uranus)", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "SolNode4": { + "value": "Acheron (Pluto)", + "enemy": "Corpus", + "type": "Exterminate" + }, + "SolNode5": { + "value": "Perdita (Uranus)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode6": { + "value": "Despina (Neptune)", + "enemy": "Corpus", + "type": "Excavation" + }, + "SolNode7": { + "value": "Epimetheus (Saturn)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode8": { + "value": "Nix (Pluto)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SolNode9": { + "value": "Rosalind (Uranus)", + "enemy": "Grineer", + "type": "Spy" + }, + "SolNode10": { + "value": "Thebe (Jupiter)", + "enemy": "Corpus", + "type": "Sabotage" + }, + "SolNode11": { + "value": "Tharsis (Mars)", + "enemy": "Corpus", + "type": "Hijack" + }, + "SolNode12": { + "value": "Elion (Mercury)", + "enemy": "Grineer", + "type": "Mobile Defense" + }, + "SolNode13": { + "value": "Bianca (Uranus)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode14": { + "value": "Ultor (Mars)", + "enemy": "Crossfire", + "type": "Exterminate" + }, + "SolNode15": { + "value": "Pacific (Earth)", + "enemy": "Grineer", + "type": "Rescue" + }, + "SolNode16": { + "value": "Augustus (Mars)", + "enemy": "Crossfire", + "type": "Rescue" + }, + "SolNode17": { + "value": "Proteus (Neptune)", + "enemy": "Corpus", + "type": "Defense" + }, + "SolNode18": { + "value": "Rhea (Saturn)", + "enemy": "Grineer", + "type": "Interception" + }, + "SolNode19": { + "value": "Enceladus (Saturn)", + "enemy": "Grineer", + "type": "Sabotage" + }, + "SolNode20": { + "value": "Telesto (Saturn)", + "enemy": "Grineer", + "type": "Exterminate" + }, + "SolNode21": { + "value": "Narcissus (Pluto)", + "enemy": "Corpus", + "type": "Exterminate" + }, + "SolNode22": { + "value": "Tessera (Venus)", + "enemy": "Corpus", + "type": "Defense" + }, + "SolNode23": { + "value": "Cytherean (Venus)", + "enemy": "Corpus", + "type": "Interception" + }, + "SolNode24": { + "value": "Oro (Earth)", + "enemy": "Grineer", + "type": "Assassination" + }, + "SolNode25": { + "value": "Callisto (Jupiter)", + "enemy": "Corpus", + "type": "Interception" + }, + "SolNode26": { + "value": "Lith (Earth)", + "enemy": "Grineer", + "type": "Defense" + }, + "SolNode27": { + "value": "E Prime (Earth)", + "enemy": "Grineer", + "type": "Exterminate" + }, + "SolNode28": { + "value": "M Prime (Mercury)", + "enemy": "Grineer", + "type": "Sabotage" + }, + "SolNode29": { + "value": "Oberon (Uranus)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode30": { + "value": "Olympus (Mars)", + "enemy": "Grineer", + "type": "Mobile Defense" + }, + "SolNode31": { + "value": "Anthe (Saturn)", + "enemy": "Grineer", + "type": "Rescue" + }, + "SolNode32": { + "value": "Tethys (Saturn)", + "enemy": "Grineer", + "type": "Assassination" + }, + "SolNode33": { + "value": "Ariel (Uranus)", + "enemy": "Grineer", + "type": "Sabotage" + }, + "SolNode34": { + "value": "Sycorax (Uranus)", + "enemy": "Grineer", + "type": "Exterminate" + }, + "SolNode35": { + "value": "Arcadia (Mars)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode36": { + "value": "Martialis (Mars)", + "enemy": "Grineer", + "type": "Rescue" + }, + "SolNode37": { + "value": "Pallene (Saturn)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode38": { + "value": "Minthe (Pluto)", + "enemy": "Corpus", + "type": "Mobile Defense" + }, + "SolNode39": { + "value": "Everest (Earth)", + "enemy": "Grineer", + "type": "Excavation" + }, + "SolNode40": { + "value": "Prospero (Uranus)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode41": { + "value": "Arval (Mars)", + "enemy": "Crossfire", + "type": "Spy" + }, + "SolNode42": { + "value": "Helene (Saturn)", + "enemy": "Grineer", + "type": "Defense" + }, + "SolNode43": { + "value": "Cerberus (Pluto)", + "enemy": "Corpus", + "type": "Interception" + }, + "SolNode44": { + "value": "Mimas (Saturn)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode45": { + "value": "Ara (Mars)", + "enemy": "Grineer", + "type": "Capture" + }, + "SolNode46": { + "value": "Spear (Mars)", + "enemy": "Grineer", + "type": "Defense" + }, + "SolNode47": { + "value": "Janus (Saturn)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode48": { + "value": "Regna (Pluto)", + "enemy": "Corpus", + "type": "Rescue" + }, + "SolNode49": { + "value": "Larissa (Neptune)", + "enemy": "Corpus", + "type": "Mobile Defense" + }, + "SolNode50": { + "value": "Numa (Saturn)", + "enemy": "Grineer", + "type": "Rescue" + }, + "SolNode51": { + "value": "Hades (Pluto)", + "enemy": "Corpus", + "type": "Assassination" + }, + "SolNode52": { + "value": "Portia (Uranus)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode53": { + "value": "Themisto (Jupiter)", + "enemy": "Corpus", + "type": "Assassination" + }, + "SolNode54": { + "value": "Silvanus (Mars)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode55": { + "value": "Methone (Saturn)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode56": { + "value": "Cypress (Pluto)", + "enemy": "Corpus", + "type": "Sabotage" + }, + "SolNode57": { + "value": "Sao (Neptune)", + "enemy": "Corpus", + "type": "Sabotage" + }, + "SolNode58": { + "value": "Hellas (Mars)", + "enemy": "Grineer", + "type": "Exterminate" + }, + "SolNode59": { + "value": "Eurasia (Earth)", + "enemy": "Grineer", + "type": "Mobile Defense" + }, + "SolNode60": { + "value": "Caliban (Uranus)", + "enemy": "Grineer", + "type": "Rescue" + }, + "SolNode61": { + "value": "Ishtar (Venus)", + "enemy": "Corpus", + "type": "Sabotage" + }, + "SolNode62": { + "value": "Neso (Neptune)", + "enemy": "Corpus", + "type": "Exterminate" + }, + "SolNode63": { + "value": "Mantle (Earth)", + "enemy": "Grineer", + "type": "Capture" + }, + "SolNode64": { + "value": "Umbriel (Uranus)", + "enemy": "Grineer", + "type": "Interception" + }, + "SolNode65": { + "value": "Gradivus (Mars)", + "enemy": "Corpus", + "type": "Sabotage" + }, + "SolNode66": { + "value": "Unda (Venus)", + "enemy": "Corpus", + "type": "Spy" + }, + "SolNode67": { + "value": "Dione (Saturn)", + "enemy": "Grineer", + "type": "Spy" + }, + "SolNode68": { + "value": "Vallis (Mars)", + "enemy": "Grineer", + "type": "Mobile Defense" + }, + "SolNode69": { + "value": "Ophelia (Uranus)", + "enemy": "Grineer", + "type": "Survival" + }, + "SolNode70": { + "value": "Cassini (Saturn)", + "enemy": "Grineer", + "type": "Capture" + }, + "SolNode71": { + "value": "Vesper (Venus)", + "enemy": "Corpus", + "type": "Spy" + }, + "SolNode72": { + "value": "Outer Terminus (Pluto)", + "enemy": "Corpus", + "type": "Defense" + }, + "SolNode73": { + "value": "Ananke (Jupiter)", + "enemy": "Corpus", + "type": "Capture" + }, + "SolNode74": { + "value": "Carme (Jupiter)", + "enemy": "Corpus", + "type": "Mobile Defense" + }, + "SolNode75": { + "value": "Cervantes (Earth)", + "enemy": "Grineer", + "type": "Sabotage" + }, + "SolNode76": { + "value": "Hydra (Pluto)", + "enemy": "Corpus", + "type": "Capture" + }, + "SolNode77": { + "value": "Cupid (Uranus)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode78": { + "value": "Triton (Neptune)", + "enemy": "Corpus", + "type": "Rescue" + }, + "SolNode79": { + "value": "Cambria (Earth)", + "enemy": "Grineer", + "type": "Spy" + }, + "SolNode80": { + "value": "Phoebe (Saturn)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode81": { + "value": "Palus (Pluto)", + "enemy": "Corpus", + "type": "Survival" + }, + "SolNode82": { + "value": "Calypso (Saturn)", + "enemy": "Grineer", + "type": "Sabotage" + }, + "SolNode83": { + "value": "Cressida (Uranus)", + "enemy": "Grineer", + "type": "Mobile Defense" + }, + "SolNode84": { + "value": "Nereid (Neptune)", + "enemy": "Corpus", + "type": "Hijack" + }, + "SolNode85": { + "value": "Gaia (Earth)", + "enemy": "Grineer", + "type": "Interception" + }, + "SolNode86": { + "value": "Aegaeon (Saturn)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode87": { + "value": "Ganymede (Jupiter)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SolNode88": { + "value": "Adrastea (Jupiter)", + "enemy": "Corpus", + "type": "Spy" + }, + "SolNode89": { + "value": "Mariana (Earth)", + "enemy": "Grineer", + "type": "Exterminate" + }, + "SolNode90": { + "value": "Miranda", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "SolNode91": { + "value": "Iapetus (Saturn)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode92": { + "value": "Charon (Pluto)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SolNode93": { + "value": "Keeler (Saturn)", + "enemy": "Grineer", + "type": "Mobile Defense" + }, + "SolNode94": { + "value": "Apollodorus (Mercury)", + "enemy": "Grineer", + "type": "Survival" + }, + "SolNode95": { + "value": "Thalassa (Neptune)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SolNode96": { + "value": "Titan (Saturn)", + "enemy": "Grineer", + "type": "Survival" + }, + "SolNode97": { + "value": "Amalthea (Jupiter)", + "enemy": "Corpus", + "type": "Spy" + }, + "SolNode98": { + "value": "Desdemona (Uranus)", + "enemy": "Grineer", + "type": "Capture" + }, + "SolNode99": { + "value": "War (Mars)", + "enemy": "Grineer", + "type": "Assassinate" + }, + "SolNode100": { + "value": "Elara (Jupiter)", + "enemy": "Corpus", + "type": "Survival" + }, + "SolNode101": { + "value": "Kiliken (Venus)", + "enemy": "Corpus", + "type": "Excavation" + }, + "SolNode102": { + "value": "Oceanum (Pluto)", + "enemy": "Corpus", + "type": "Spy" + }, + "SolNode103": { + "value": "Terminus (Mercury)", + "enemy": "Grineer", + "type": "Capture" + }, + "SolNode104": { + "value": "Fossa (Venus)", + "enemy": "Corpus", + "type": "Assassinate" + }, + "SolNode105": { + "value": "Titania (Uranus)", + "enemy": "Grineer", + "type": "Assassination" + }, + "SolNode106": { + "value": "Alator (Mars)", + "enemy": "Grineer", + "type": "Interception" + }, + "SolNode107": { + "value": "Venera (Venus)", + "enemy": "Corpus", + "type": "Capture" + }, + "SolNode108": { + "value": "Tolstoj (Mercury)", + "enemy": "Grineer", + "type": "Assassinate" + }, + "SolNode109": { + "value": "Linea (Venus)", + "enemy": "Corpus", + "type": "Rescue" + }, + "SolNode110": { + "value": "Hyperion (Saturn)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode111": { + "value": "Juliet (Uranus)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode112": { + "value": "Setebos (Uranus)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode113": { + "value": "Ares (Mars)", + "enemy": "Grineer", + "type": "Sabotage" + }, + "SolNode114": { + "value": "Puck (Uranus)", + "enemy": "Grineer", + "type": "Exterminate" + }, + "SolNode115": { + "value": "Quirinus (Mars)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode116": { + "value": "Mab (Uranus)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode117": { + "value": "Naiad (Neptune)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SolNode118": { + "value": "Laomedeia (Neptune)", + "enemy": "Corpus", + "type": "Spy" + }, + "SolNode119": { + "value": "Caloris (Mercury)", + "enemy": "Grineer", + "type": "Rescue" + }, + "SolNode120": { + "value": "Halimede (Neptune)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SolNode121": { + "value": "Carpo (Jupiter)", + "enemy": "Corpus", + "type": "Exterminate" + }, + "SolNode122": { + "value": "Stephano (Uranus)", + "enemy": "Grineer", + "type": "Defense" + }, + "SolNode123": { + "value": "V Prime (Venus)", + "enemy": "Corpus", + "type": "Survival" + }, + "SolNode124": { + "value": "Trinculo (Uranus)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode125": { + "value": "Io (Jupiter)", + "enemy": "Corpus", + "type": "Defense" + }, + "SolNode126": { + "value": "Metis (Jupiter)", + "enemy": "Corpus", + "type": "Rescue" + }, + "SolNode127": { + "value": "Psamathe (Neptune)", + "enemy": "Corpus", + "type": "Assassination" + }, + "SolNode128": { + "value": "E Gate (Venus)", + "enemy": "Corpus", + "type": "Exterminate" + }, + "SolNode129": { + "value": "SolNode129", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "SolNode130": { + "value": "Lares (Mercury)", + "enemy": "Grineer", + "type": "Defense" + }, + "SolNode131": { + "value": "Pallas (Ceres)", + "enemy": "Grineer", + "type": "Exterminate" + }, + "SolNode132": { + "value": "Bode (Ceres)", + "enemy": "Grineer", + "type": "Spy" + }, + "SolNode133": { + "value": "Vedic (Ceres)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode134": { + "value": "Varro (Ceres)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode135": { + "value": "Thon (Ceres)", + "enemy": "Grineer", + "type": "Sabotage" + }, + "SolNode136": { + "value": "Olla (Ceres)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode137": { + "value": "Nuovo (Ceres)", + "enemy": "Grineer", + "type": "Rescue" + }, + "SolNode138": { + "value": "Ludi (Ceres)", + "enemy": "Grineer", + "type": "Hijack" + }, + "SolNode139": { + "value": "Lex (Ceres)", + "enemy": "Grineer", + "type": "Capture" + }, + "SolNode140": { + "value": "Kiste (Ceres)", + "enemy": "Grineer", + "type": "Mobile Defense" + }, + "SolNode141": { + "value": "Ker (Ceres)", + "enemy": "Grineer", + "type": "Sabotage" + }, + "SolNode142": { + "value": "Hapke (Ceres)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode143": { + "value": "Gefion (Ceres)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode144": { + "value": "Exta (Ceres)", + "enemy": "Grineer", + "type": "Assassination" + }, + "SolNode145": { + "value": "Egeria (Ceres)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode146": { + "value": "Draco (Ceres)", + "enemy": "Grineer", + "type": "Survival" + }, + "SolNode147": { + "value": "Cinxia (Ceres)", + "enemy": "Grineer", + "type": "Interception" + }, + "SolNode148": { + "value": "Cerium (Ceres)" + }, + "SolNode149": { + "value": "Casta (Ceres)", + "enemy": "Grineer", + "type": "Defense" + }, + "SolNode150": { + "value": "Albedo (Ceres)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode151": { + "value": "Acanth (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode152": { + "value": "Ascar (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode153": { + "value": "Brugia (Eris)", + "enemy": "Infested", + "type": "Rescue" + }, + "SolNode154": { + "value": "Candiru (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode155": { + "value": "Cosis (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode156": { + "value": "Cyath (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode157": { + "value": "Giardia (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode158": { + "value": "Gnathos (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode159": { + "value": "Lepis (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode160": { + "value": "Histo (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode161": { + "value": "Hymeno (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode162": { + "value": "Isos (Eris)", + "enemy": "Infested", + "type": "Capture" + }, + "SolNode163": { + "value": "Ixodes (Eris)" + }, + "SolNode164": { + "value": "Kala-azar (Eris)", + "enemy": "Infested", + "type": "Defense" + }, + "SolNode165": { + "value": "Sporid (Eris)", + "enemy": "Infested", + "type": "Hive Sabotage" + }, + "SolNode166": { + "value": "Nimus (Eris)", + "enemy": "Infested", + "type": "Survival" + }, + "SolNode167": { + "value": "Oestrus (Eris)", + "enemy": "Infested", + "type": "Mobile Defense" + }, + "SolNode168": { + "value": "Phalan (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode169": { + "value": "Psoro (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode170": { + "value": "Ranova (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode171": { + "value": "Saxis (Eris)", + "enemy": "Infested", + "type": "Exterminate" + }, + "SolNode172": { + "value": "Xini (Eris)", + "enemy": "Infested", + "type": "Interception" + }, + "SolNode173": { + "value": "Solium (Eris)", + "enemy": "Infested", + "type": "Mobile Defense" + }, + "SolNode174": { + "value": "Sparga (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode175": { + "value": "Naeglar (Eris)", + "enemy": "Infested", + "type": "Hive" + }, + "SolNode176": { + "value": "Viver (Eris)", + "enemy": "Infested", + "type": "Ancient Retribution" + }, + "SolNode177": { + "value": "Kappa (Sedna)", + "enemy": "Grineer", + "type": "Spy" + }, + "SolNode178": { + "value": "Hyosube (Sedna)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode179": { + "value": "Jengu (Sedna)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode180": { + "value": "Undine (Sedna)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode181": { + "value": "Adaro (Sedna)", + "enemy": "Grineer", + "type": "Exterminate" + }, + "SolNode182": { + "value": "Camenae (Sedna)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode183": { + "value": "Vodyanoi (Sedna)", + "enemy": "Grineer", + "type": "Arena" + }, + "SolNode184": { + "value": "Rusalka (Sedna)", + "enemy": "Grineer", + "type": "Capture" + }, + "SolNode185": { + "value": "Berehynia (Sedna)", + "enemy": "Grineer", + "type": "Interception" + }, + "SolNode186": { + "value": "Phithale (Sedna)", + "enemy": "Grineer", + "type": "Sabotage" + }, + "SolNode187": { + "value": "Selkie (Sedna)", + "enemy": "Grineer", + "type": "Survival" + }, + "SolNode188": { + "value": "Kelpie (Sedna)", + "enemy": "Grineer", + "type": "Sabotage" + }, + "SolNode189": { + "value": "Naga (Sedna)", + "enemy": "Grineer", + "type": "Rescue" + }, + "SolNode190": { + "value": "Nakki (Sedna)", + "enemy": "Grineer", + "type": "Arena" + }, + "SolNode191": { + "value": "Marid (Sedna)", + "enemy": "Grineer", + "type": "Hijack" + }, + "SolNode192": { + "value": "Tikoloshe (Sedna)", + "enemy": "Grineer", + "type": "Spy" + }, + "SolNode193": { + "value": "Merrow (Sedna)", + "enemy": "Grineer", + "type": "Assassination" + }, + "SolNode194": { + "value": "Ponaturi (Sedna)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode195": { + "value": "Hydron (Sedna)", + "enemy": "Grineer", + "type": "Defense" + }, + "SolNode196": { + "value": "Charybdis (Sedna)", + "enemy": "Grineer", + "type": "Mobile Defense" + }, + "SolNode197": { + "value": "Graeae (Sedna)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode198": { + "value": "Scylla (Sedna)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode199": { + "value": "Yam (Sedna)", + "enemy": "Grineer", + "type": "Arena" + }, + "SolNode200": { + "value": "Veles (Sedna)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode201": { + "value": "Tiamat (Sedna)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode202": { + "value": "Yemaja (Sedna)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode203": { + "value": "Abaddon (Europa)", + "enemy": "Corpus", + "type": "Capture" + }, + "SolNode204": { + "value": "Armaros (Europa)", + "enemy": "Corpus", + "type": "Exterminate" + }, + "SolNode205": { + "value": "Baal (Europa)", + "enemy": "Corpus", + "type": "Mobile Defense" + }, + "SolNode206": { + "value": "Eligor (Europa)" + }, + "SolNode207": { + "value": "Gamygyn (Europa)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SolNode208": { + "value": "Lillith (Europa)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SolNode209": { + "value": "Morax (Europa)", + "enemy": "Corpus", + "type": "Mobile Defense" + }, + "SolNode210": { + "value": "Naamah (Europa)", + "enemy": "Corpus", + "type": "Assassination" + }, + "SolNode211": { + "value": "Ose (Europa)", + "enemy": "Corpus", + "type": "Interception" + }, + "SolNode212": { + "value": "Paimon (Europa)", + "enemy": "Corpus", + "type": "Defense" + }, + "SolNode213": { + "value": "Shax (Europa)" + }, + "SolNode214": { + "value": "Sorath (Europa)", + "enemy": "Corpus", + "type": "Hijack" + }, + "SolNode215": { + "value": "Valac (Europa)", + "enemy": "Corpus", + "type": "Spy" + }, + "SolNode216": { + "value": "Valefor (Europa)", + "enemy": "Corpus", + "type": "Excavation" + }, + "SolNode217": { + "value": "Orias (Europa)", + "enemy": "Corpus", + "type": "Rescue" + }, + "SolNode218": { + "value": "Zagan (Europa)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SolNode219": { + "value": "Beleth (Europa)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SolNode220": { + "value": "Kokabiel (Europa)", + "enemy": "Corpus", + "type": "Sabotage" + }, + "SolNode221": { + "value": "Neruda (Mercury)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode222": { + "value": "Eminescu (Mercury)", + "enemy": "Grineer", + "type": "Ancient Retribution" + }, + "SolNode223": { + "value": "Boethius (Mercury)", + "enemy": "Grineer", + "type": "Exterminate" + }, + "SolNode224": { + "value": "Odin (Mercury)", + "enemy": "Grineer", + "type": "Interception" + }, + "SolNode225": { + "value": "Suisei (Mercury)", + "enemy": "Grineer", + "type": "Spy" + }, + "SolNode226": { + "value": "Pantheon (Mercury)", + "enemy": "Grineer", + "type": "Exterminate" + }, + "SolNode227": { + "value": "Verdi (Mercury)" + }, + "SolNode228": { + "value": "Plains of Eidolon (Earth)", + "enemy": "Grineer", + "type": "Free Roam" + }, + "SolNode400": { + "value": "Teshub (Void)", + "enemy": "Corrupted", + "type": "Exterminate" + }, + "SolNode401": { + "value": "Hepit (Void)", + "enemy": "Corrupted", + "type": "Capture" + }, + "SolNode402": { + "value": "Taranis (Void)", + "enemy": "Corrupted", + "type": "Defense" + }, + "SolNode403": { + "value": "Tiwaz (Void)", + "enemy": "Corrupted", + "type": "Mobile Defense" + }, + "SolNode404": { + "value": "Stribog (Void)", + "enemy": "Corrupted", + "type": "Orokin Sabotage" + }, + "SolNode405": { + "value": "Ani (Void)", + "enemy": "Corrupted", + "type": "Survival" + }, + "SolNode406": { + "value": "Ukko (Void)", + "enemy": "Corrupted", + "type": "Capture" + }, + "SolNode407": { + "value": "Oxomoco (Void)", + "enemy": "Corrupted", + "type": "Exterminate" + }, + "SolNode408": { + "value": "Belenus (Void)", + "enemy": "Corrupted", + "type": "Defense" + }, + "SolNode409": { + "value": "Mot (Void)", + "enemy": "Corrupted", + "type": "Survival" + }, + "SolNode410": { + "value": "Aten (Void)", + "enemy": "Corrupted", + "type": "Mobile Defense" + }, + "SolNode411": { + "value": "SolNode411 (Void)", + "enemy": "Corrupted", + "type": "Ancient Retribution" + }, + "SolNode412": { + "value": "Mithra (Void)", + "enemy": "Corrupted", + "type": "Interception" + }, + "SolNode413": { + "value": "SolNode413 (Void)", + "enemy": "Corrupted", + "type": "Ancient Retribution" + }, + "SolNode741": { + "value": "Koro (Kuva Fortress)", + "enemy": "Grineer", + "type": "Assault" + }, + "SolNode742": { + "value": "Nabuk (Kuva Fortress)", + "enemy": "Grineer", + "type": "Capture" + }, + "SolNode743": { + "value": "Rotuma (Kuva Fortress)", + "enemy": "Grineer", + "type": "Mobile Defense" + }, + "SolNode744": { + "value": "Taveuni (Kuva Fortress)", + "enemy": "Grineer", + "type": "Survival" + }, + "SolNode745": { + "value": "Tamu (Kuva Fortress)", + "enemy": "Grineer", + "type": "Defense" + }, + "SolNode746": { + "value": "Dakata (Kuva Fortress)", + "enemy": "Grineer", + "type": "Extermination" + }, + "SolNode747": { + "value": "Pago (Kuva Fortress)", + "enemy": "Grineer", + "type": "Spy" + }, + "SolNode748": { + "value": "Garus (Kuva Fortress)", + "enemy": "Grineer", + "type": "Rescue" + }, + "SolNode901": { + "value": "Caduceus", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "SolNode902": { + "value": "Montes (Venus)", + "enemy": "Corpus", + "type": "Exterminate (Archwing)" + }, + "SolNode903": { + "value": "Erpo (Earth)", + "enemy": "Grineer", + "type": "Mobile Defense (Archwing)" + }, + "SolNode904": { + "value": "Syrtis (Mars)", + "enemy": "Grineer", + "type": "Exterminate (Archwing)" + }, + "SolNode905": { + "value": "Galilea (Jupiter)", + "enemy": "Corpus", + "type": "Sabotage (Archwing)" + }, + "SolNode906": { + "value": "Pandora (Saturn)", + "enemy": "Grineer", + "type": "Pursuit (Archwing)" + }, + "SolNode907": { + "value": "Caelus (Uranus)", + "enemy": "Grineer", + "type": "Interception (Archwing)" + }, + "SolNode908": { + "value": "Salacia (Neptune)", + "enemy": "Corpus", + "type": "Mobile Defense (Archwing)" + }, + "SolNode300": { + "value": "Plato (Lua)", + "enemy": "Grineer", + "type": "Exterminate" + }, + "SolNode301": { + "value": "Grimaldi (Lua)", + "enemy": "Grineer", + "type": "Mobile Defense" + }, + "SolNode302": { + "value": "Tycho (Lua)", + "enemy": "Corpus", + "type": "Survival" + }, + "SolNode304": { + "value": "Copernicus (Lua)", + "enemy": "Grineer", + "type": "Mobile Defense" + }, + "SolNode305": { + "value": "Stöfler (Lua)", + "enemy": "Corpus", + "type": "Survival" + }, + "SolNode306": { + "value": "Pavlov (Lua)", + "enemy": "Corpus", + "type": "Spy" + }, + "SolNode307": { + "value": "Zeipel (Lua)", + "enemy": "Corpus", + "type": "Rescue" + }, + "SettlementNode1": { + "value": "Roche (Phobos)", + "enemy": "Corpus", + "type": "Exterminate" + }, + "SettlementNode2": { + "value": "Skyresh (Phobos)", + "enemy": "Corpus", + "type": "Capture" + }, + "SettlementNode3": { + "value": "Stickney (Phobos)", + "enemy": "Corpus", + "type": "Survival" + }, + "SettlementNode4": { + "value": "Drunlo (Phobos)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SettlementNode5": { + "value": "Grildrig (Phobos)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SettlementNode6": { + "value": "Limtoc (Phobos)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SettlementNode7": { + "value": "Hall (Phobos)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SettlementNode8": { + "value": "Reldresal (Phobos)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SettlementNode9": { + "value": "Clustril (Phobos)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SettlementNode10": { + "value": "Kepler (Phobos)", + "enemy": "Corpus", + "type": "Rush (Archwing)" + }, + "SettlementNode11": { + "value": "Gulliver (Phobos)", + "enemy": "Corpus", + "type": "Defense" + }, + "SettlementNode12": { + "value": "Monolith (Phobos)", + "enemy": "Corpus", + "type": "Rescue" + }, + "SettlementNode13": { + "value": "D'Arrest (Phobos)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SettlementNode14": { + "value": "Shklovsky (Phobos)", + "enemy": "Corpus", + "type": "Spy" + }, + "SettlementNode15": { + "value": "Sharpless (Phobos)", + "enemy": "Corpus", + "type": "Mobile Defense" + }, + "SettlementNode16": { + "value": "Wendell (Phobos)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SettlementNode17": { + "value": "Flimnap (Phobos)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SettlementNode18": { + "value": "Opik (Phobos)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SettlementNode19": { + "value": "Todd (Phobos)", + "enemy": "Corpus", + "type": "Ancient Retribution" + }, + "SettlementNode20": { + "value": "Iliad (Phobos)", + "enemy": "Corpus", + "type": "Assassination" + }, + "MercuryHUB": { + "value": "Larunda Relay (Mercury)", + "enemy": "Grineer", + "type": "Relay" + }, + "VenusHUB": { + "value": "Vesper Relay (Venus)", + "enemy": "Corpus", + "type": "Relay" + }, + "EarthHUB": { + "value": "Strata Relay (Earth)", + "enemy": "Grineer", + "type": "Relay" + }, + "SaturnHUB": { + "value": "Kronia Relay (Saturn)", + "enemy": "Grineer", + "type": "Relay" + }, + "ErisHUB": { + "value": "Kuiper Relay (Eris)", + "enemy": "Infested", + "type": "Relay" + }, + "EuropaHUB": { + "value": "Leonov Relay (Europa)", + "enemy": "Corpus", + "type": "Relay" + }, + "PlutoHUB": { + "value": "Orcus Relay (Pluto)", + "enemy": "Corpus", + "type": "Relay" + }, + "EventNode0": { + "value": "Balor", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode1": { + "value": "Tethra", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode2": { + "value": "Operation Gate Crash", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode3": { + "value": "Elatha", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode4": { + "value": "Bres", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode5": { + "value": "Birog", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode6": { + "value": "Tyl Reygor Seal Lab", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode7": { + "value": "Buarainech", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode8": { + "value": "Corb", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode9": { + "value": "Operation Gate Crash Pt. 2", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode10": { + "value": "Lugh", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode11": { + "value": "Nemed", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode12": { + "value": "Operation Cryotic Front", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode13": { + "value": "Shifting Sands", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode14": { + "value": "Gate Crash", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode15": { + "value": "Operation Cryotic Front", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode16": { + "value": "Operation Cryotic Front", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode17": { + "value": "Operation Cryotic Front", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode18": { + "value": "Operation Blackout Pt. 1", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode19": { + "value": "Operation Blackout Pt. 1", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode20": { + "value": "Tyl Regor Sea Lab", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode22": { + "value": "Tyl Regor Sea Lab", + "enemy": "Sentient", + "type": "Ancient Retribution" + }, + "EventNode761": { + "value": "The Index", + "enemy": "Corpus", + "type": "Arena" + }, + "EventNode762": { + "value": "The Index pt 2", + "enemy": "Corpus", + "type": "Arena" + }, + "EventNode763": { + "value": "The Index Endurance", + "enemy": "Corpus", + "type": "Arena" + }, + "PvpNode0": { + "value": "Conclave Capture the Cephalon", + "enemy": "Tenno", + "type": "Conclave" + }, + "PvpNode1": { + "value": "Conclave", + "enemy": "Tenno", + "type": "Conclave" + }, + "PvpNode2": { + "value": "Conclave", + "enemy": "Tenno", + "type": "Conclave" + }, + "PvpNode3": { + "value": "Conclave Capture the Cephalon", + "enemy": "Tenno", + "type": "Conclave" + }, + "PvpNode4": { + "value": "Conclave", + "enemy": "Tenno", + "type": "Conclave" + }, + "PvpNode5": { + "value": "Conclave", + "enemy": "Tenno", + "type": "Conclave" + }, + "PvpNode6": { + "value": "Conclave", + "enemy": "Tenno", + "type": "Conclave" + }, + "PvpNode7": { + "value": "Conclave", + "enemy": "Tenno", + "type": "Conclave" + }, + "PvpNode8": { + "value": "Conclave", + "enemy": "Tenno", + "type": "Conclave" + }, + "PvpNode9": { + "value": "Conclave Team Domination", + "enemy": "Tenno", + "type": "Conclave" + }, + "PvpNode10": { + "value": "Conclave Domination", + "enemy": "Tenno", + "type": "Conclave" + }, + "PvpNode11": { + "value": "Conclave Domination", + "enemy": "Tenno", + "type": "Conclave" + }, + "PvpNode12": { + "value": "Conclave Domination", + "enemy": "Tenno", + "type": "Conclave" + }, + "PvpNode13": { + "value": "Tactical Alert: Snoball Fight!", + "enemy": "Tenno", + "type": "Conclave" + }, + "PvpNode14": { + "value": "Conclave: Quick Steel", + "enemy": "Tenno", + "type": "Conclave" + }, + "ClanNode0": { + "value": "Romula (Venus)", + "enemy": "Infested", + "type": "Dark Sector Defense" + }, + "ClanNode1": { + "value": "Malva (Venus)", + "enemy": "Infested", + "type": "Dark Sector Survival" + }, + "ClanNode2": { + "value": "Coba (Earth)", + "enemy": "Infested", + "type": "Dark Sector Defense" + }, + "ClanNode3": { + "value": "Tikal (Earth)", + "enemy": "Infested", + "type": "Dark Sector Excavation" + }, + "ClanNode4": { + "value": "Sinai (Jupiter)", + "enemy": "Infested", + "type": "Dark Sector Survival" + }, + "ClanNode5": { + "value": "Cameria (Jupiter)", + "enemy": "Infested", + "type": "Dark Sector Survival" + }, + "ClanNode6": { + "value": "Larzac (Europa)", + "enemy": "Infested", + "type": "Dark Sector Defense" + }, + "ClanNode7": { + "value": "Cholistan (Europa)", + "enemy": "Infested", + "type": "Dark Sector Excavation" + }, + "ClanNode8": { + "value": "Kadesh (Mars)", + "enemy": "Infested", + "type": "Dark Sector Defense" + }, + "ClanNode9": { + "value": "Wahiba (Mars)", + "enemy": "Infested", + "type": "Dark Sector Survival" + }, + "ClanNode10": { + "value": "Memphis (Phobos)", + "enemy": "Infested", + "type": "Dark Sector Defection" + }, + "ClanNode11": { + "value": "Zeugma (Phobos)", + "enemy": "Infested", + "type": "Dark Sector Survival" + }, + "ClanNode12": { + "value": "Caracol (Saturn)", + "enemy": "Infested", + "type": "Dark Sector Defense" + }, + "ClanNode13": { + "value": "Piscinas (Saturn)", + "enemy": "Infested", + "type": "Dark Sector Survival" + }, + "ClanNode14": { + "value": "Amarna (Sedna)", + "enemy": "Infested", + "type": "Dark Sector Survival" + }, + "ClanNode15": { + "value": "Sangeru (Sedna)", + "enemy": "Infested", + "type": "Dark Sector Defense" + }, + "ClanNode16": { + "value": "Ur (Uranus)", + "enemy": "Infested", + "type": "Dark Sector Defense" + }, + "ClanNode17": { + "value": "Assur (Uranus)", + "enemy": "Infested", + "type": "Dark Sector Sabotage" + }, + "ClanNode18": { + "value": "Akkad (Eris)", + "enemy": "Infested", + "type": "Dark Sector Defense" + }, + "ClanNode19": { + "value": "Zabala (Eris)", + "enemy": "Infested", + "type": "Dark Sector Survival" + }, + "ClanNode20": { + "value": "Yursa (Neptune)", + "enemy": "Infested", + "type": "Dark Sector Defense" + }, + "ClanNode21": { + "value": "Kelashin (Neptune)", + "enemy": "Infested", + "type": "Dark Sector Survival" + }, + "ClanNode22": { + "value": "Seimeni (Ceres)", + "enemy": "Infested", + "type": "Dark Sector Defense" + }, + "ClanNode23": { + "value": "Gabii (Ceres)", + "enemy": "Infested", + "type": "Dark Sector Survival" + }, + "ClanNode24": { + "value": "Sechura (Pluto)", + "enemy": "Infested", + "type": "Dark Sector Defense" + }, + "ClanNode25": { + "value": "Hieracon (Pluto)", + "enemy": "Infested", + "type": "Dark Sector Excavation" + }, + "/Lotus/Types/Keys/SortieBossKeyPhorid": { + "value": "Sortie Boss: Phorid", + "enemy": "Infested", + "type": "Assassination" + } +} diff --git a/warbot.py b/warbot.py new file mode 100755 index 0000000..785b6f0 --- /dev/null +++ b/warbot.py @@ -0,0 +1,194 @@ +#!/usr/bin/env python3 +""" +An IRC bot which tracks new alerts and invasions for Warframe and reports +them to channel. Only intended to be used in one channel at a time. +""" +import os +import json +import time +import functools +import threading +import configparser + +import requests +from twisted.internet import protocol, reactor +from twisted.words.protocols import irc + +URI = "http://content.warframe.com/dynamic/worldState.php" + + +class ClockThread(threading.Thread): + """ + A thread class which acts like a clock for signaling the bot to check + the world state every minute. + """ + def __init__(self, bot): + threading.Thread.__init__(self) + self.bot = bot + + + def run(self): + while not stop.is_set(): + self.bot.checkNewAlerts() + stop.wait(60) + + +class WarBot(irc.IRCClient): + def __init__(self, config): + self.config = config + self.nickname = self.config["nickname"] + self.username = self.config["ident"] + self.channel = self.config["channel"] + + with open(os.path.join("static", "languages.json"), "r") as file: + self.languages = json.loads(file.read()) + + with open(os.path.join("static", "missionTypes.json"), "r") as file: + self.missionTypes = json.loads(file.read()) + + with open(os.path.join("static", "solNodes.json"), "r") as file: + self.solNodes = json.loads(file.read()) + + self.clockThread = ClockThread(self) + self.clockThread.start() + + self.alert_ids = [] + + + def stillConnected(self): + """Returns true if the bot is still connected to the server.""" + if self._heartbeat: + return True + else: + return False + + + def clock(self): + """ + A continous loop which calls the processing functions once per + minute. Should only be ran in a separate thread. + """ + while not stop.is_set(): + self.checkNewAlerts() + stop.wait(60) + + + def checkNewAlerts(self): + """ + Checks the world state for new alerts or invasions. + """ + while not self.stillConnected(): # startup reasons + time.sleep(1) + + try: + res = requests.get(URI) + res.raise_for_status() + except requests.exceptions.ConnectionError: + return + data = res.json() + + alert_ids = [alert["_id"]["$oid"] for alert in data["Alerts"]] + + new_alerts = [a for a in alert_ids if a not in self.alert_ids] + self.alert_ids += new_alerts + for alert in data["Alerts"]: + if alert["_id"]["$oid"] in new_alerts: + self.process_alert(alert) + + expired_alerts = [a for a in self.alert_ids if a not in alert_ids] + for alert_id in expired_alerts: + self.alert_ids.remove(alert_id) + + + def process_alert(self, alert): + """ + Processes the provided alert and sends a message to channel. + """ + info = alert["MissionInfo"] + node = self.solNodes[info["location"]] + mission_type = self.missionTypes[info["missionType"]]["value"] + credits = info["missionReward"].get("credits") + items = info["missionReward"].get("items", []) + if items: + items = [self.languages[item.lower()]["value"] for item in items] + cItems = info["missionReward"].get("countedItems") + if cItems: + for item in cItems: + itemStr = f"({item['ItemCount']}) " + itemStr += self.languages[item["ItemType"].lower()]["value"] + items.append(itemStr) + + expire = int(alert["Expiry"]["$date"]["$numberLong"]) + expire_diff = int(expire/1000 - time.time()) + expire_t = time.localtime(expire) + + message = "\x0300[\x0305ALERT\x0300] " \ + + f"\x0310Location\x03: \x0312{node['value']}\x03 | " \ + + f"\x0310Mission Type\x03: \x0312{mission_type}\x03 | " \ + + f"\x0310Expiry\x03: \x0308{expire_diff // 3600}h" \ + + f"{expire_diff % 3600 // 60}m\x03 " \ + + f"(\x0308{time.strftime('%H:%M', expire_t)}\x03)" \ + + f" | \x0310Credits\x03: \x0312{credits}\x03" + if items: + message += f" | \x0310Items: \x0312{', '.join(items)}\x03" + + self.msg(self.channel, message) + + + def privmsg(self, user, channel, message): + """ + Called when the bot receives a PRIVMSG, which can come from channels + or users alike. + """ + pass + + + def joined(self, channel): + """Called when the bot joins a new channel.""" + print("Joined", channel) + + + def signedOn(self): + """Called when the bot successfully connects to the server.""" + print("Signed on as", self.nickname) + self.mode(self.nickname, True, "B") # set +B on self + self.join(self.channel) + + + def nickChanged(self, nick): + """Called when my nick has been changed.""" + print("Nick changed to", nick) + + +class WarBotFactory(protocol.ReconnectingClientFactory): + # black magic going on here + protocol = property(lambda s: functools.partial(WarBot, s.config)) + + def __init__(self, config): + self.config = config + + +stop = threading.Event() +if __name__ == "__main__": + import argparse + + parser = argparse.ArgumentParser( + description="Downloads new torrents from a torrent tracker's IRC " \ + + "announce channel.") + parser.add_argument( + "-c", + "--config", + default="config.cfg", + help="Specify an alternate config file to use.") + args = parser.parse_args() + + config = configparser.ConfigParser() + config.read(args.config) + config = config[config.sections()[0]] #only use the first section + + server = config["server"] + port = config.getint("port") + print("Connecting to:", server) + reactor.connectTCP(server, port, WarBotFactory(config)) + reactor.addSystemEventTrigger('before','shutdown', stop.set) + reactor.run()